SLC38A7 Recombinant monoclonal antibody, PBS Only (Detector) 83346-4-PBS proteintech
$699.00
In stock
SKU
83346-4-PBS
| Catalog Number | 83346-4-PBS |
| Synonyms | SNAT7, FLJ10815, FLJ12724, Sodium-coupled neutral amino acid transporter 7, Solute carrier family 38 member 7 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag35081 Product name: Recombinant human SLC38A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC001961 Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST Predict reactive species |
| Full Name | solute carrier family 38, member 7 |
| Calculated Molecular Weight | 50 kDa |
| GenBank Accession Number | BC001961 |
| Gene Symbol | SLC38A7 |
| Gene ID (NCBI) | 55238 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NVC3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240147B4 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
