SLC38A9 Recombinant monoclonal antibody, PBS Only 83182-5-PBS proteintech
$699.00
In stock
SKU
83182-5-PBS
| Catalog Number | 83182-5-PBS |
| Synonyms | URLC11, Up-regulated in lung cancer 11, Solute carrier family 38 member 9, Neutral amino acid transporter 9, 240039E7 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag15607 Product name: Recombinant human SLC38A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC066891 Sequence: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIPPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMM Predict reactive species |
| Full Name | solute carrier family 38, member 9 |
| Calculated Molecular Weight | 561 aa, 64 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC066891 |
| Gene Symbol | SLC38A9 |
| Gene ID (NCBI) | 153129 |
| RRID | AB_3670872 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8NBW4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240039E7 |
| Conjugation | Unconjugated |
The mTOR complex 1 (mTORC1) protein kinase is a master growth regulator that responds to multiple environmental cues. The lysosomal amino acid transporter SLC38A9 is a physical and functional component of this sensing complex. SLC38A9 (Solute Carrier Family 38 Member 9) was first identified as a potential amino acid transporter belonging to the slc38 family. SLC38A9 has some isoforms: 64,53,57 kDa.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
