ZIP7 Polyclonal antibody 19429-1-AP proteintech
$149.00
In stock
SKU
19429-1-AP
| Catalog Number | 19429-1-AP |
| Synonyms | SLC39A7, ZIP 7, D6S115E, D6S2244E, H2 KE4 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells, HepG2 cells, Calu-1 cells, L02 cells, HeLa cells |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | human kidney tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | A549 cells, HepG2 cells, Calu-1 cells, L02 cells, HeLa cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human kidney tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag13762 Product name: Recombinant human SLC39A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 237-384 aa of BC000645 Sequence: VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ Predict reactive species |
| Full Name | solute carrier family 39 (zinc transporter), member 7 |
| Calculated Molecular Weight | 469 aa, 50 kDa |
| Observed Molecular Weight | 45-50 kDa, 56 kDa |
| GenBank Accession Number | BC000645 |
| Gene Symbol | ZIP7 |
| Gene ID (NCBI) | 7922 |
| RRID | AB_10643376 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92504 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for ZIP7 antibody 19429-1-AP | Download protocol |
| IHC protocol for ZIP7 antibody 19429-1-AP | Download protocol |
| IP protocol for ZIP7 antibody 19429-1-AP | Download protocol |
| WB protocol for ZIP7 antibody 19429-1-AP | Download protocol |
| Human | Nat Commun The methyltransferase METTL9 mediates pervasive 1-methylhistidine modification in mammalian proteomes. Authors - Erna Davydova View Article |
| mouse | WB Metallomics Deregulation of biometal homeostasis: the missing link for neuronal ceroid lipofuscinoses? Authors - Alexandra Grubman View Article |
| human | WB Cell Death Differ Systematic genetic mapping of necroptosis identifies SLC39A7 as modulator of death receptor trafficking. Authors - Astrid Fauster View Article |
| Citations | 24 |
| Dilutions | WB : 1:2000-1:12000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
ZIP7 is a functional zinc transporter transporting zinc from the Golgi apparatus to the cytoplasm of the cell. ZIP7 is post-translationally regulated by CK2-mediated phosphorylation. This ZIP7 phosphorylation results in zinc release from intracellular stores, which activates multiple tyrosine kinases and regulate cell survival and proliferation. Dual bands of 50 kDa and 56 kDa detected by this antibody may represent the native and phosphorylated forms of ZIP7, respectively. (PMID: 28232492, 28205653) Protocols Product Specific Protocols IF protocol for ZIP7 antibody 19429-1-AP Download protocol IHC protocol for ZIP7 antibody 19429-1-AP Download protocol IP protocol for ZIP7 antibody 19429-1-AP Download protocol WB protocol for ZIP7 antibody 19429-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The methyltransferase METTL9 mediates pervasive 1-methylhistidine modification in mammalian proteomes.
Journal: Nat Commun | Authors: Erna Davydova | Species: Human - X-ray fluorescence imaging reveals subcellular biometal disturbances in a childhood neurodegenerative disorder.
Journal: Chem Sci | Authors: A Grubman | Species: mouse | Application: WB - Systematic genetic mapping of necroptosis identifies SLC39A7 as modulator of death receptor trafficking.
Journal: Cell Death Differ | Authors: Astrid Fauster | Species: human | Application: WB - Deregulation of subcellular biometal homeostasis through loss of the metal transporter, Zip7, in a childhood neurodegenerative disorder.
Journal: Acta Neuropathol Commun | Authors: Alexandra Grubman KD Validated | Species: mouse | Application: WB,IF - PMID: 25969539
Journal: J Biol Chem | Authors: Ying Liu | Species: mouse | Application: IF - Deregulation of biometal homeostasis: the missing link for neuronal ceroid lipofuscinoses?
Journal: Metallomics | Authors: Alexandra Grubman | Species: mouse | Application: WB - The Zn2+ transporter ZIP7 enhances endoplasmic-reticulum-associated protein degradation and prevents neurodegeneration in Drosophila
Journal: Dev Cell | Authors: Xiaoran Guo | Species: human | Application: WB,IF - METTL9 mediated N1-Histidine methylation of SLC39A7 confers ferroptosis resistance and inhibits adipogenic differentiation in mesenchymal stem cells
Journal: Mol Med | Authors: Jiahao Jin | Species: human | Application: WB,IP - X-ray fluorescence imaging reveals subcellular biometal disturbances in a childhood neurodegenerative disorder.
Journal: Chem Sci | Authors: A Grubman | Species: mouse | Application: WB - Deregulation of subcellular biometal homeostasis through loss of the metal transporter, Zip7, in a childhood neurodegenerative disorder.
Journal: Acta Neuropathol Commun | Authors: Alexandra Grubman | Species: mouse | Application: WB,IF - Zinc Uptake and Storage During the Formation of the Cerebral Cortex in Mice.
Journal: Mol Neurobiol | Authors: Jessy Hasna | Species: mouse | Application: WB - B cell activation and proliferation increase intracellular zinc levels.
Journal: J Nutr Biochem | Authors: Johanna Ollig | Species: human | Application: WB - NVS-ZP7-4 inhibits hepatocellular carcinoma tumorigenesis and promotes apoptosis via PI3K/AKT signaling
Journal: Sci Rep | Authors: Qing Tong | Species: human | Application: WB - Knockdown of SLC39A7 inhibits cell growth and induces apoptosis in human colorectal cancer cells.
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Nengquan Sheng | Species: human | Application: WB - Characterization of Zinc Influx Transporters (ZIPs) in Pancreatic Beta Cells: Roles in Regulating Cytosolic Zinc Homeostasis and Insulin Secretion.
Journal: J Biol Chem | Authors: Ying Liu | Species: mouse | Application: IF - Prolonged stimulation of insulin release from MIN6 cells causes zinc depletion and loss of β-cell markers.
Journal: J Trace Elem Med Biol | Authors: Rebecca Lawson | Species: mouse | Application: IF - Expression profiles of SLC39A/ZIP7, ZIP8 and ZIP14 in response to exercise-induced skeletal muscle damage.
Journal: J Trace Elem Med Biol | Authors: Jingyun Liu | Species: rat | Application: IF - X-ray fluorescence microscopic measurement of elemental distribution in the mouse retina with age.
Journal: Metallomics | Authors: Alexandra Grubman | Species: mouse | Application: IF - Deregulation of biometal homeostasis: the missing link for neuronal ceroid lipofuscinoses?
Journal: Metallomics | Authors: Alexandra Grubman | Species: mouse | Application: WB - X-ray fluorescence microscopic measurement of elemental distribution in the mouse retina with age.
Journal: Metallomics | Authors: Alexandra Grubman | Species: mouse | Application: IF - Zinc transporter SLC39A7 relieves zinc deficiency to suppress alternative macrophage activation and impairment of phagocytosis.
Journal: PLoS One | Authors: Wenyan Xie | Species: human | Application: WB - Altered biometal homeostasis is associated with CLN6 mRNA loss in mouse neuronal ceroid lipofuscinosis.
Journal: Biol Open | Authors: Kanninen Katja M KM | Species: mouse | Application: WB,IHC - The importance of targeting signalling mechanisms of the SLC39A family of zinc transporters to inhibit endocrine resistant breast cancer.
Journal: Explor Target Antitumor Ther | Authors: Samuel Jones | Species: human | Application: WB,IHC - Machine learning-based identification and immune characterization of ferroptosis-related molecular clusters in osteoarthritis and validation
Journal: Aging (Albany NY) | Authors: Xiaocheng Guo | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
