Band 3/AE 1 Polyclonal antibody 28131-1-AP proteintech
$149.00
In stock
SKU
28131-1-AP
| Catalog Number | 28131-1-AP |
| Synonyms | band 3, band 3/ AE1, SLC4A1, AE 1, AE1 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, IP, ELISA |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | COLO 320 cells, mouse liver tissue |
| Tested Applications — Positive IHC detected in | human spleen tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human placenta tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | COLO 320 cells, mouse liver tissue |
| Positive IHC detected in | human spleen tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag27878 Product name: Recombinant human SLC4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC101570 Sequence: MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLF Predict reactive species |
| Full Name | solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group) |
| Calculated Molecular Weight | 911 aa, 102 kDa |
| Observed Molecular Weight | 95-100 kDa |
| GenBank Accession Number | BC101570 |
| Gene Symbol | band 3 |
| Gene ID (NCBI) | 6521 |
| RRID | AB_2881069 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02730 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Band 3/AE 1 antibody 28131-1-AP | Download protocol |
| IHC protocol for Band 3/AE 1 antibody 28131-1-AP | Download protocol |
| WB protocol for Band 3/AE 1 antibody 28131-1-AP | Download protocol |
| human | IF Phytomedicine Trans-resveratrol mitigates miR-204-3p mediated progression of allergic rhinitis by regulating the EGLN3/HIF-1α/IL33/ST2 signalling pathway Authors - Wei Mao View Article |
| mouse | IHC Neuron Single-cell dissection of the human blood-brain barrier and glioma blood-tumor barrier Authors - Yuan Xie View Article |
| Citations | 12 |
| Dilutions | WB : 1:200-1:1000 IHC : 1:50-1:500 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Anion exchanger 1 (AE1), also known as band 3, is a 95-100 kDa transmembrane glycoprotein which is abundantly expressed in erythrocyte plasma membrane and mediates the electroneutral exchange of Cl- and HCO3-. It contains a 52-55 kDa C-terminal membrane crossing domain and a 43 kDa N-terminal cytoplasmic domain. Degradation of band 3 protein occurred during erythrocyte aging. The oxidative stress can also activate the proteolysis of band 3 through caspases. Protocols Product Specific Protocols IF protocol for Band 3/AE 1 antibody 28131-1-AP Download protocol IHC protocol for Band 3/AE 1 antibody 28131-1-AP Download protocol WB protocol for Band 3/AE 1 antibody 28131-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The mTORC1-SLC4A7 axis stimulates bicarbonate import to enhance de novo nucleotide synthesis.
Journal: Mol Cell | Authors: Eunus S Ali | Species: human | Application: WB - Band 3 ectopic expression in colorectal cancer induces an increase in erythrocyte membrane-bound IgG and may cause immune-related anemia.
Journal: Int J Hematol | Authors: Akihito Kitao | Species: human | Application: IP - Piezo1 as a force-through-membrane sensor in red blood cells
Journal: eLife | Authors: George Vaisey | Species: mouse | Application: IF - Three novel heterozygous ANK1 loss-of-function variants cause hereditary spherocytosis in Chinese families
Journal: Ann Hematol | Authors: Yang Wang | Species: human | Application: WB - Single-cell dissection of the human blood-brain barrier and glioma blood-tumor barrier
Journal: Neuron | Authors: Yuan Xie | Species: mouse | Application: IHC - Trans-resveratrol mitigates miR-204-3p mediated progression of allergic rhinitis by regulating the EGLN3/HIF-1α/IL33/ST2 signalling pathway
Journal: Phytomedicine | Authors: Wei Mao | Species: human | Application: IF - Ferric citrate and apo-transferrin enable erythroblast maturation with β-globin from hemogenic endothelium
Journal: NPJ Regen Med | Authors: Soo-Been Jeon | Species: human | Application: IF - Identification of Proteins Associated with Ovarian Cancer Chemotherapy Resistance Using MALDI-MSI
Journal: Int J Mol Sci | Authors: Tannith M Noye | Species: human | Application: IHC - Three novel heterozygous ANK1 loss-of-function variants cause hereditary spherocytosis in Chinese families
Journal: Ann Hematol | Authors: Yang Wang | Species: human | Application: WB - Band 3 ectopic expression in colorectal cancer induces an increase in erythrocyte membrane-bound IgG and may cause immune-related anemia.
Journal: Int J Hematol | Authors: Akihito Kitao | Species: human | Application: IP - High-altitude hypoxia exposure inhibits erythrophagocytosis by inducing macrophage ferroptosis in the spleen
Journal: Elife | Authors: Wan-Ping Yang | Species: mouse | Application: IF - Piezo1 as a force-through-membrane sensor in red blood cells
Journal: eLife | Authors: George Vaisey | Species: mouse | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
