SLC6A12 Recombinant monoclonal antibody, PBS Only (Capture) 83195-2-PBS proteintech
$699.00
In stock
SKU
83195-2-PBS
| Catalog Number | 83195-2-PBS |
| Synonyms | BGT 1, BGT1, BGT-1, Na(+)/Cl(-) betaine/GABA transporter, Sodium- and chloride-dependent betaine transporter |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag18778 Product name: Recombinant human SLC6A12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 548-614 aa of BC126215 Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL Predict reactive species |
| Full Name | solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 |
| Calculated Molecular Weight | 614 aa, 69 kDa |
| GenBank Accession Number | BC126215 |
| Gene Symbol | SLC6A12 |
| Gene ID (NCBI) | 6539 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P48065 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240021C8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
