SLC6A7 Recombinant monoclonal antibody, PBS Only 83412-4-PBS proteintech
$699.00
In stock
SKU
83412-4-PBS
| Catalog Number | 83412-4-PBS |
| Synonyms | Sodium-dependent proline transporter, PROT, 240395H5 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag34413 Product name: Recombinant human SLC6A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-214 aa of BC093785 Sequence: AYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHIQGSQGIGSPGEIR Predict reactive species |
| Full Name | solute carrier family 6 (neurotransmitter transporter, L-proline), member 7 |
| Calculated Molecular Weight | 636 aa, 71 kDa |
| GenBank Accession Number | BC093785 |
| Gene Symbol | SLC6A7 |
| Gene ID (NCBI) | 6534 |
| RRID | AB_3671059 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q99884 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240395H5 |
| Conjugation | Unconjugated |
SLC6A7 also known as PROT, belongs to the solute Carrier 6 gene family. SLC6A7 is a high-affinity mammalian brain L-proline transporter, which is different from other sodium-dependent plasma membrane carriers, and has unique pharmacological specificity, kinetic properties, and ionic requirements. SLC6A7 is a brain specific sodium (and chloride)-dependent proline transporter, that terminates the action of proline by its high affinity sodium-dependent reuptake into presynaptic terminals(PMID: 7651355).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
