SLN Polyclonal antibody 18395-1-AP proteintech
$149.00
In stock
SKU
18395-1-AP
| Catalog Number | 18395-1-AP |
| Synonyms | sarcolipin |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, squirrel |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Applications | IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | PC-3 cells |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Tested Reactivity | human |
| Cited Reactivity | squirrel |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag13176 Product name: Recombinant human SLN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-31 aa of BC005261 Sequence: MGINTRELFLNFTIVLITVILMWLLVRSYQY Predict reactive species |
| Full Name | sarcolipin |
| Calculated Molecular Weight | 31 aa, 4 kDa |
| GenBank Accession Number | BC005261 |
| Gene Symbol | SLN |
| Gene ID (NCBI) | 6588 |
| RRID | AB_2286622 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00631 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SLN antibody 18395-1-AP | Download protocol |
| IHC protocol for SLN antibody 18395-1-AP | Download protocol |
| Citations | 14 |
| Dilutions | IHC : 1:50-1:500 IF/ICC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SLN, also named as Sarcolipin, belongs to the sarcolipin family. It is associated with calcium ATPase SERCA1. It inhibits SERCA pumps. SLN, a key regulator of cardiac sarco(endo)plasmic reticulum (SR) Ca(2+) ATPase, is predominantly expressed in atria and mediates β-adrenergic responses. SLN can self-assembly to dimer and oligomer for playing importantphysiological function. Protocols Product Specific Protocols IF protocol for SLN antibody 18395-1-AP Download protocol IHC protocol for SLN antibody 18395-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Maternal exercise intergenerationally drives muscle-based thermogenesis via activation of apelin-AMPK signaling.
Journal: EBioMedicine | Authors: Jun Seok Son | Application: WB - Identification of Small Ankyrin 1 as a Novel Sarco(endo)plasmic Reticulum Ca2+-ATPase 1 (SERCA1) Regulatory Protein in Skeletal Muscle.
Journal: J Biol Chem | Authors: Patrick F Desmond | Application: WB - Ca(2+) permeation and/or binding to CaV1.1 fine-tunes skeletal muscle Ca(2+) signaling to sustain muscle function.
Journal: Skelet Muscle | Authors: Chang Seok Lee | Application: WB - Interactions between small ankyrin 1 and sarcolipin coordinately regulate activity of the sarco(endo)plasmic reticulum Ca2+-ATPase (SERCA1).
Journal: J Biol Chem | Authors: Patrick F Desmond - ChREBP-β regulates thermogenesis in brown adipose tissue.
Journal: J Endocrinol | Authors: Chunchun Wei | Application: WB - Effect of sarcolipin-mediated cell transdifferentiation in sarcopenia-associated skeletal muscle fibrosis.
Journal: Exp Cell Res | Authors: Qiu-Nan Chen | Application: IF - A Temporal Examination of Cytoplasmic Ca2 + Levels, Sarcoplasmic Reticulum Ca2 + Levels, and Ca2 + -Handling-Related Proteins in Different Skeletal Muscles of Hibernating Daurian Ground Squirrels.
Journal: Front Physiol | Authors: Zhe Wang | Species: squirrel | Application: WB,IF - Interactions between small ankyrin 1 and sarcolipin coordinately regulate activity of the sarco(endo)plasmic reticulum Ca2+-ATPase (SERCA1).
Journal: J Biol Chem | Authors: Patrick F Desmond - Identification of Small Ankyrin 1 as a Novel Sarco(endo)plasmic Reticulum Ca2+-ATPase 1 (SERCA1) Regulatory Protein in Skeletal Muscle.
Journal: J Biol Chem | Authors: Patrick F Desmond | Application: WB - Ca(2+) permeation and/or binding to CaV1.1 fine-tunes skeletal muscle Ca(2+) signaling to sustain muscle function.
Journal: Skelet Muscle | Authors: Chang Seok Lee | Application: WB - Effect of sarcolipin-mediated cell transdifferentiation in sarcopenia-associated skeletal muscle fibrosis.
Journal: Exp Cell Res | Authors: Qiu-Nan Chen | Application: IF - Sarcolipin Exhibits Abundant RNA Transcription and Minimal Protein Expression in Horse Gluteal Muscle.
Journal: Vet Sci | Authors: Joseph M Autry | Application: WB - O-GlcNAcylation of SERCA protects skeletal muscle in hibernating Spermophilus dauricus from disuse atrophy
Journal: Comp Biochem Physiol B Biochem Mol Biol | Authors: Kai Dang | Application: IF - (-)-epicatechin treatment did not modify the thermogenic pathway in the gastrocnemius muscle of male rat offspring obeses by programming
Journal: J Dev Orig Health Dis | Authors: María Elena Tejeda | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
