ALDH1L2 Monoclonal antibody, PBS Only (Detector) 60405-5-PBS proteintech
$699.00
In stock
SKU
60405-5-PBS
| Catalog Number | 60405-5-PBS |
| Synonyms | PBS Only |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17340 Product name: Recombinant human ALDH1L2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-103 aa of BC103935 Sequence: MVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPIIEDS Predict reactive species |
| Full Name | aldehyde dehydrogenase 1 family, member L2 |
| Calculated Molecular Weight | 923 aa, 102 kDa |
| GenBank Accession Number | BC103935 |
| Gene Symbol | ALDH1L2 |
| Gene ID (NCBI) | 160428 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q3SY69 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1H7E6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
