SMPX Polyclonal antibody 15791-1-AP proteintech
$149.00
In stock
SKU
15791-1-AP
| Catalog Number | 15791-1-AP |
| Synonyms | small muscle protein, X linked, Small muscular protein, SRMX, Stretch-responsive skeletal muscle protein |
| Host | Rabbit |
| Reactivity | human, mouse, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | pig skeletal muscle tissue, human skeletal muscle tissue, human colon tissue, pig colon tissue |
| Tested Applications — Positive IHC detected in | human kidney tissue, human brain tissue, human lung tissue, human ovary tissue, human spleen tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Positive WB detected in | pig skeletal muscle tissue, human skeletal muscle tissue, human colon tissue, pig colon tissue |
| Positive IHC detected in | human kidney tissue, human brain tissue, human lung tissue, human ovary tissue, human spleen tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Tested Reactivity | human, mouse, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8497 Product name: Recombinant human SMPX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC005948 Sequence: MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ Predict reactive species |
| Full Name | small muscle protein, X-linked |
| Calculated Molecular Weight | 88 aa, 10 kDa |
| Observed Molecular Weight | 9 kDa |
| GenBank Accession Number | BC005948 |
| Gene Symbol | SMPX |
| Gene ID (NCBI) | 23676 |
| RRID | AB_2193527 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UHP9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SMPX antibody 15791-1-AP | Download protocol |
| IHC protocol for SMPX antibody 15791-1-AP | Download protocol |
| WB protocol for SMPX antibody 15791-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 IF-P : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
