SMUG1 Recombinant monoclonal antibody, PBS Only 83771-4-PBS proteintech
$699.00
In stock
SKU
83771-4-PBS
| Catalog Number | 83771-4-PBS |
| Synonyms | EC:3.2.2.-, FDG, HMUDG, Single-strand selective monofunctional uracil DNA glycosylase, UNG3 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag13934 Product name: Recombinant human SMUG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC000417 Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQS Predict reactive species |
| Full Name | single-strand-selective monofunctional uracil-DNA glycosylase 1 |
| Calculated Molecular Weight | 177 aa, 20 kDa |
| GenBank Accession Number | BC000417 |
| Gene Symbol | SMUG1 |
| Gene ID (NCBI) | 23583 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q53HV7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240817G6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
