SNRPB2 Polyclonal antibody 13512-1-AP proteintech
$149.00
In stock
SKU
13512-1-AP
| Catalog Number | 13512-1-AP |
| Synonyms | U2 snRNP B'', U2 snRNP B, U2 small nuclear ribonucleoprotein B'' |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, RIP, ELISA |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, human brain tissue, human kidney tissue, human liver tissue, mouse liver tissue, mouse lung tissue |
| Tested Applications — Positive IP detected in | mouse liver tissue |
| Tested Applications — Positive IHC detected in | human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, human brain tissue, human kidney tissue, human liver tissue, mouse liver tissue, mouse lung tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4436 Product name: Recombinant human SNRPB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC036737 Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK Predict reactive species |
| Full Name | small nuclear ribonucleoprotein polypeptide B'' |
| Calculated Molecular Weight | 225 aa, 26, 5 kDa |
| Observed Molecular Weight | 25-31 kDa |
| GenBank Accession Number | BC036737 |
| Gene Symbol | SNRPB2 |
| Gene ID (NCBI) | 6629 |
| RRID | AB_2302390 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08579 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SNRPB2 antibody 13512-1-AP | Download protocol |
| IHC protocol for SNRPB2 antibody 13512-1-AP | Download protocol |
| IP protocol for SNRPB2 antibody 13512-1-AP | Download protocol |
| WB protocol for SNRPB2 antibody 13512-1-AP | Download protocol |
| human | WB STAR Protoc Protocol for proteogenomic dissection of intronic splicing enhancer interactome for prediction of individualized cancer prognosis. Authors - Li Wang View Article |
| Melissa (Verified Customer) (03-16-2020) | This antibody works incredibly robust in western blot analysis. However, we do observe a non-specific band in all of our blots which we have attributed to snRPA due to the size and sequence similarity of the immunogen. Applications: Western Blot, Primary Antibody Dilution: 1:1000 Cell Tissue Type: HeLa Cell Nuclear Extract |
| John (Verified Customer) (12-06-2018) | Applications: Western Blot, Cell Tissue Type: HeLa SNRPB2 Antibody Western Blot, validation ( dilution) in HeLa (Cat no:13512-1-AP) |
| Citations | 14 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
U2 small nuclear ribonucleoprotein B''(SNRPB2) is part of the U2 RNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. Only in presence of the U2A' protein, SNRPB2 binds stem loop IV of U2 snRNA. Protocols Product Specific Protocols IF protocol for SNRPB2 antibody 13512-1-AP Download protocol IHC protocol for SNRPB2 antibody 13512-1-AP Download protocol IP protocol for SNRPB2 antibody 13512-1-AP Download protocol WB protocol for SNRPB2 antibody 13512-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- CPEB1 coordinates alternative 3'-UTR formation with translational regulation.
Journal: Nature | Authors: Felice-Alessio Bava | Species: human | Application: WB - Drug screening for ALS using patient-specific induced pluripotent stem cells.
Journal: Sci Transl Med | Authors: Naohiro Egawa | Species: human | Application: IF - Comment on "Drug screening for ALS using patient-specific induced pluripotent stem cells".
Journal: Sci Transl Med | Authors: Bilada Bilican | Species: human | Application: WB,IHC - Stoichiometries of U2AF35, U2AF65 and U2 snRNP reveal new early spliceosome assembly pathways.
Journal: Nucleic Acids Res | Authors: Li Chen | Species: human | Application: WB - Novel RNA-Affinity Proteogenomics Dissects Tumor Heterogeneity for Revealing Personalized Markers in Precision Prognosis of Cancer.
Journal: Cell Chem Biol | Authors: Li Wang | Species: human | Application: WB - Protocol for proteogenomic dissection of intronic splicing enhancer interactome for prediction of individualized cancer prognosis.
Journal: STAR Protoc | Authors: Li Wang | Species: human | Application: WB - SNRPB2 facilitates esophageal squamous cell carcinoma oncogenesis and progression via E2F4 stabilization.
Journal: Front Immunol | Authors: Feng Xu | Species: human | Application: WB,IHC - SNRPB2 promotes triple-negative breast cancer progression by controlling alternative splicing of MDM4 pre-mRNA
Journal: Cancer Sci | Authors: Shiyi Yu | Species: human | Application: WB,RIP - Small Nuclear Ribonucleoprotein Polypeptides B and B1 Promote Osteosarcoma Progression via Activating the Ataxia-Telangiectasia Mutated Signaling Pathway through Ribonucleotide Reductase Subunit M2
Journal: Am J Pathol | Authors: Yongxiang Shi | Species: human | Application: WB - SNRPB2 in the pan-cancer landscape: A bioinformatics exploration and validation in hepatocellular carcinoma
Journal: Cell Signal | Authors: Bowen Li | Species: human | Application: WB,IHC,IF - A model for DHX15 mediated disassembly of A-complex spliceosomes
Journal: RNA | Authors: Hannah M Maul-Newby | Species: human | Application: IP,WB - Emerging roles for SNRPB2 in governing the cell cycle and steering tumor immune modulation in breast cancer.
Journal: Mol Biol Rep | Authors: Jiazhennan Zhang | Species: human | Application: WB - Multi-Omics Analysis of Survival-Related Splicing Factors and Identifies CRNKL1 as a Therapeutic Target in Esophageal Cancer
Journal: Genes (Basel) | Authors: Tianrui Gao | Species: human | Application: IHC - Protocol for proteogenomic dissection of intronic splicing enhancer interactome for prediction of individualized cancer prognosis.
Journal: STAR Protoc | Authors: Li Wang | Species: human | Application: WB - Mutant TP53 hijacks RNA-splicing factor RBM28 to suppress double-stranded RNA triggered antitumor immunity.
Journal: Nat Commun | Authors: Tao Xiang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
