SPOCK1 Polyclonal antibody 28203-1-AP proteintech
$149.00
In stock
SKU
28203-1-AP
| Catalog Number | 28203-1-AP |
| Synonyms | Protein SPOCK, SPOCK, TESTICAN, Testican 1, Testican-1 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, PC-3 cells, DU 145 cells, mouse brain tissue, mouse stomach tissue |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Positive WB detected in | HeLa cells, PC-3 cells, DU 145 cells, mouse brain tissue, mouse stomach tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag28213 Product name: Recombinant human SPOCK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 97-236 aa of BC030691 Sequence: CVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGR Predict reactive species |
| Full Name | sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1 |
| Calculated Molecular Weight | 439 aa, 49 kDa |
| Observed Molecular Weight | 49 kDa |
| GenBank Accession Number | BC030691 |
| Gene Symbol | SPOCK1 |
| Gene ID (NCBI) | 6695 |
| RRID | AB_3086036 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08629 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for SPOCK1 antibody 28203-1-AP | Download protocol |
| WB protocol for SPOCK1 antibody 28203-1-AP | Download protocol |
| human | IF BMC Cancer The co-location of MARCO + macrophages and SPOCK1 + fibroblasts contributes to the poor prognosis and undesirable immunotherapy response in colorectal cancer. Authors - Yuhao Pan View Article |
| Citations | 3 |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:400-1:1600 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Shared chemoresistance genes in ESCC and cervical Cancer: Insights from pharmacogenomics and Mendelian randomization
Journal: Int Immunopharmacol | Authors: Ziyu Liu | Species: human | Application: IHC - Extrachromosomal circular DNA-related SPOCK1 contributes to development and enzalutamide resistance of prostate cancer by regulating epithelial mesenchymal transition
Journal: Heliyon | Authors: Yicong Yao | Species: human | Application: WB,IHC - The co-location of MARCO + macrophages and SPOCK1 + fibroblasts contributes to the poor prognosis and undesirable immunotherapy response in colorectal cancer.
Journal: BMC Cancer | Authors: Yuhao Pan | Species: human | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
