SPON2 Polyclonal antibody 20513-1-AP proteintech
$149.00
In stock
SKU
20513-1-AP
| Catalog Number | 20513-1-AP |
| Synonyms | DIL 1, DIL1, M spondin, Mindin, SPON2, Spondin 2 |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | LNCaP cells |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue, human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | LNCaP cells |
| Positive IHC detected in | human prostate cancer tissue, human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14337 Product name: Recombinant human SPON2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 32-221 aa of BC002707 Sequence: ESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHP Predict reactive species |
| Full Name | spondin 2, extracellular matrix protein |
| Calculated Molecular Weight | 331 aa, 36 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC002707 |
| Gene Symbol | SPON2 |
| Gene ID (NCBI) | 10417 |
| RRID | AB_2878696 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BUD6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for SPON2 antibody 20513-1-AP | Download protocol |
| WB protocol for SPON2 antibody 20513-1-AP | Download protocol |
| human | IHC Front Oncol Knockdown of SPON2 inhibits the growth of triple-negative breast cancer Authors - Xueyi Hu View Article |
| human,mouse | WB,IF Front Cell Dev Biol Transcriptional Activation of Matricellular Protein Spondin2 (SPON2) by BRG1 in Vascular Endothelial Cells Promotes Macrophage Chemotaxis. Authors - Nan Li View Article |
| Citations | 11 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SPON2 (Spondin 2), also known as Mindin, is a member of the F-spondin family of secreted extracellular matrix proteins. This protein has been implicated in axon guidance, immune response and adhesion. SPON2 is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens (PMID: 14691481). It also functions as an integrin ligand for inflammatory cell recruitment and T-cell priming (PMID: 19153605). Besides, SPON2 has been reported as a prognostic biomarker for ovarian and prostate cancer (PMID: 17490732; 22615945; 23665271). Protocols Product Specific Protocols IHC protocol for SPON2 antibody 20513-1-AP Download protocol WB protocol for SPON2 antibody 20513-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Spatial immune scoring system predicts hepatocellular carcinoma recurrence
Journal: Nature | Authors: Gengjie Jia | Species: human | Application: IF - Spondin 2 promotes the proliferation, migration and invasion of gastric cancer cells.
Journal: J Cell Mol Med | Authors: Haoming Lu KD Validated | Species: human | Application: WB - Integrative Analysis of DNA Methylation and Transcriptome Identifies a Predictive Epigenetic Signature Associated With Immune Infiltration in Gliomas.
Journal: Front Cell Dev Biol | Authors: Jianlei Zhang | Species: human | Application: IHC - Transcriptional Activation of Matricellular Protein Spondin2 (SPON2) by BRG1 in Vascular Endothelial Cells Promotes Macrophage Chemotaxis.
Journal: Front Cell Dev Biol | Authors: Nan Li | Species: human,mouse | Application: WB,IF - Impaired natural killer cell maturation in lung adenocarcinoma driven by FABP4 and SPON2 downregulation through disrupted lipid metabolism
Journal: Transl Lung Cancer Res | Authors: Hongxia Tian | Application: IHC - Knockdown of SPON2 inhibits the growth of triple-negative breast cancer
Journal: Front Oncol | Authors: Xueyi Hu | Species: human | Application: IHC - Knockdown of SPON2 inhibits the growth of triple-negative breast cancer
Journal: Front Oncol | Authors: Xueyi Hu | Species: human | Application: IHC - Impaired natural killer cell maturation in lung adenocarcinoma driven by FABP4 and SPON2 downregulation through disrupted lipid metabolism
Journal: Transl Lung Cancer Res | Authors: Hongxia Tian | Application: IHC - Spon2 knockdown suppresses the phenotype of house dust mite-induced allergic asthma in mice and cells.
Journal: Immunol Res | Authors: Haihan Zheng | Species: mouse | Application: WB,IF - SPON2 acts as a tumor promoter in HR-positive/HER2-negative breast cancer by regulating β-catenin signaling.
Journal: Clin Breast Cancer | Authors: Gu-Yue Liu | Species: human | Application: WB,IHC - Calycosin ameliorates inflammation and M1 macrophage polarization via Spon2 in LPS-triggered MH-S alveolar macrophages.
Journal: J Nat Med | Authors: Gaoyan Chen | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
