SRPX2 Polyclonal antibody 11845-1-AP proteintech
$149.00
In stock
SKU
11845-1-AP
| Catalog Number | 11845-1-AP |
| Synonyms | BPP, CBPS, PMGX, RESDX, SRPUL |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human placenta tissue, human kidney tissue, human brain tissue, HepG2 cells |
| Tested Applications — Positive IHC detected in | human placenta tissue, human brain tissue, human heart tissue, human kidney tissue, human lung tissue, human skin tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | rat brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Positive WB detected in | human placenta tissue, human kidney tissue, human brain tissue, HepG2 cells |
| Positive IHC detected in | human placenta tissue, human brain tissue, human heart tissue, human kidney tissue, human lung tissue, human skin tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2516 Product name: Recombinant human SRPX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-465 aa of BC020733 Sequence: DGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGASCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE Predict reactive species |
| Full Name | sushi-repeat-containing protein, X-linked 2 |
| Calculated Molecular Weight | 465 aa, 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC020733 |
| Gene Symbol | SRPX2 |
| Gene ID (NCBI) | 27286 |
| RRID | AB_2195006 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60687 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SRPX2 antibody 11845-1-AP | Download protocol |
| IHC protocol for SRPX2 antibody 11845-1-AP | Download protocol |
| WB protocol for SRPX2 antibody 11845-1-AP | Download protocol |
| human | WB,IHC Int J Clin Exp Pathol SRPX2 promotes cell migration and invasion via FAK dependent pathway in pancreatic cancer. Authors - Zhenyuan Gao View Article |
| mouse | WB Int J Mol Sci The Role of Lysosomes in a Broad Disease-Modifying Approach Evaluated across Transgenic Mouse Models of Alzheimer's Disease and Parkinson's Disease and Models of Mild Cognitive Impairment. Authors - Jeannie Hwang View Article |
| Citations | 10 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:20-1:200 IF-P : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SRPX2 (sushi-repeat-containing protein, X-linked 2) is a secreted protein expressed in neurons of the human adult brain, including the rolandic area (PMID: 20874700). Firstly described as sushi-repeat protein up-regulated in leukemia (SPRUL) in leukemia cells with dysregulated expression at the transcriptional level, SRPX2 has been recently shown as a multifunctional protein. SRPX2 is a ligand for uPAR, the urokinase-type plasminogen activator (uPA) receptor (PMID: 18718938). It is involved in seizure disorders, angiogenesis and cellular adhesion (PMID: 22242148; 19667118; 16497722). The involvement of SRPX2 in disorders of language cortex and cognition suggests it has an important role in the perisylvian region critical for language development (PMID: 16497722). Protocols Product Specific Protocols IF protocol for SRPX2 antibody 11845-1-AP Download protocol IHC protocol for SRPX2 antibody 11845-1-AP Download protocol WB protocol for SRPX2 antibody 11845-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Local administration of liposomal-based Srpx2 gene therapy reverses pulmonary fibrosis by blockading fibroblast-to-myofibroblast transition.
Journal: Theranostics | Authors: Qi Wang KD Validated | Species: human | Application: WB - Epileptic and developmental disorders of the speech cortex: ligand/receptor interaction of wild-type and mutant SRPX2 with the plasminogen activator receptor uPAR.
Journal: Hum Mol Genet | Authors: Royer-Zemmour Barbara B | Species: human | Application: WB - Sushi repeat protein X-linked 2, a novel mediator of angiogenesis.
Journal: FASEB J | Authors: Miljkovic-Licina Marijana M | Species: mouse | Application: WB - The Landscape of the Tumor Microenvironment in Skin Cutaneous Melanoma Reveals a Prognostic and Immunotherapeutically Relevant Gene Signature.
Journal: Front Cell Dev Biol | Authors: Sitong Zhou | Species: human | Application: IHC - The Role of Lysosomes in a Broad Disease-Modifying Approach Evaluated across Transgenic Mouse Models of Alzheimer's Disease and Parkinson's Disease and Models of Mild Cognitive Impairment.
Journal: Int J Mol Sci | Authors: Jeannie Hwang | Species: mouse | Application: WB - SRPX2 promotes cell migration and invasion via FAK dependent pathway in pancreatic cancer.
Journal: Int J Clin Exp Pathol | Authors: Zhenyuan Gao | Species: human | Application: WB,IHC - Epileptic and developmental disorders of the speech cortex: ligand/receptor interaction of wild-type and mutant SRPX2 with the plasminogen activator receptor uPAR.
Journal: Hum Mol Genet | Authors: Royer-Zemmour Barbara B | Species: human | Application: WB - Srpx2 exerts multifaceted cardio-protection in septic cardiomyopathy: PI3K/AKT-dependent attenuation of mitochondrial oxidative stress, apoptotic signaling, and inflammatory response.
Journal: Hum Cell | Authors: Yan Guo | Species: rat | Application: IHC - SOX4 promotes triple-negative breast cancer progression by promoting SRPX2 transcription to regulate AKR1C1
Journal: J Mol Histol | Authors: Weiwei Ge - SRPX2 promotes cell migration and invasion via FAK dependent pathway in pancreatic cancer.
Journal: Int J Clin Exp Pathol | Authors: Zhenyuan Gao | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
