Fibronectin Polyclonal antibody 15613-1-AP proteintech
$149.00
In stock
SKU
15613-1-AP
| Catalog Number | 15613-1-AP |
| Synonyms | FN1, Anastellin, CIG, Cold insoluble globulin, Cold-insoluble globulin |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (6) |
| Reactivity | human, mouse, rat, pig, rabbit, canine, hamster, sheep, medaka embryos |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, IF-P, FC (Intra), IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human plasma, NIH/3T3 cells, MDA-MB-453s cells |
| Tested Applications — Positive IP detected in | NIH/3T3 cells |
| Tested Applications — Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | rat skin tissue, mouse brain tissue |
| Tested Applications — Positive IF/ICC detected in | NIH/3T3 cells, HUVEC cells |
| Tested Applications — Positive FC (Intra) detected in | NIH/3T3 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:20000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | human plasma, NIH/3T3 cells, MDA-MB-453s cells |
| Positive IP detected in | NIH/3T3 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat skin tissue, mouse brain tissue |
| Positive IF/ICC detected in | NIH/3T3 cells, HUVEC cells |
| Positive FC (Intra) detected in | NIH/3T3 cells |
| Western Blot (WB) | WB : 1:2000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine, hamster, sheep, medaka embryos |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8004 Product name: Recombinant human FN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2177-2386 aa of BC005858 Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE Predict reactive species |
| Full Name | fibronectin 1 |
| Calculated Molecular Weight | 2386 aa, 263 kDa |
| Observed Molecular Weight | 250-275 kDa |
| GenBank Accession Number | BC005858 |
| Gene Symbol | Fibronectin |
| Gene ID (NCBI) | 2335 |
| RRID | AB_2105691 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02751 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Fibronectin antibody 15613-1-AP | Download protocol |
| IF protocol for Fibronectin antibody 15613-1-AP | Download protocol |
| IHC protocol for Fibronectin antibody 15613-1-AP | Download protocol |
| IP protocol for Fibronectin antibody 15613-1-AP | Download protocol |
| WB protocol for Fibronectin antibody 15613-1-AP | Download protocol |
| rat | Adv Mater Neonatal Tissue-derived Extracellular Vesicle Therapy (NEXT): A Potent Strategy for Precision Regenerative Medicine Authors - Peng Lou View Article |
| mouse | IF J Clin Invest Mitochondrial dysfunction in macrophages promotes inflammation and suppresses repair after myocardial infarction Authors - Shanshan Cai View Article |
| human | Nat Commun Schwann cells regulate tumor cells and cancer-associated fibroblasts in the pancreatic ductal adenocarcinoma microenvironment Authors - Meilin Xue View Article |
| S (Verified Customer) (01-06-2026) | excellent Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Mouse lung Fibronectin Antibody Western Blot validation (1:1000 dilution) in Mouse lung (Cat no:15613-1-AP) |
| Zach (Verified Customer) (08-29-2025) | This antibody works great with chronic pancreatitis samples. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: pancreas |
| Ilaria (Verified Customer) (08-11-2025) | The fibronectin antibody performed very well, providing a strong and clear signal even at a higher dilution of 1:500. It was tested on mouse brain samples that were snap-frozen after collection using dry ice and 2-methylbutane, then post-fixed with acetone and ethanol. Blood vessel structures were clearly visualised, and the antibody also allowed for the assessment of BBB leakage. Applications: Immunofluorescence Primary Antibody Dilution: 1:500 Cell Tissue Type: Mouse brain |
| Angie (Verified Customer) (07-26-2025) | WB showed a single band above 250 kDa at dilution of 1:500 incubated overnight at 4 °C. Secondary antibody: Donkey-anti-rabbit (Alexa Fluor 680) at 1:20000 dilution incubated at room temperature for 1 hour. Applications: Western Blot Primary Antibody Dilution: 1:500 Cell Tissue Type: A549 Fibronectin Antibody Western Blot validation (1:500 dilution) in A549 (Cat no:15613-1-AP) |
| Christelle (Verified Customer) (12-19-2024) | Immunofluorescence analysis of (PFA 4%) fixed and (BSA 1%, Saponin 0.1%) permeabilized HRMC cells using the Fibronectin antibody #15613-1-AP at dilution 1:100 and goat anti-rabbit antibody AF488 labelled, Abberior STAR Red membrane probe (yellow), Dapi (nucleus, blue). Find attached 2 files : - merged channels: dapi, green - merged channels: dapi, green, yellow Applications: Immunofluorescence Primary Antibody Dilution: 1:100 Cell Tissue Type: Human renal mesangial cells (HMRC) Fibronectin Antibody Immunofluorescence validation (1:100 dilution) in Human renal mesangial cells (HMRC) (Cat no:15613-1-AP) |
| Ruchi (Verified Customer) (06-02-2023) | The Ab was tried on mouse skin on diabetic wounds. Applications: Immunofluorescence Primary Antibody Dilution: 1:50 Cell Tissue Type: Mouse skin Fibronectin Antibody Immunofluorescence validation (1:50 dilution) in Mouse skin (Cat no:15613-1-AP) |
| PK (Verified Customer) (03-20-2023) | excellent Applications: Western Blot Primary Antibody Dilution: 1000 Cell Tissue Type: fibroblast Fibronectin Antibody Western Blot validation (1000 dilution) in fibroblast (Cat no:15613-1-AP) |
| Susanne (Verified Customer) (08-23-2022) | under reduced conditions, blocked with 5% milk powder, incubation over night 4°C Applications: Western Blot Primary Antibody Dilution: 1 : 1000 Cell Tissue Type: supernatant from human primary fibroblasts (serumfree !) Fibronectin Antibody Western Blot validation (1 : 1000 dilution) in supernatant from human primary fibroblasts (serumfree !) (Cat no:15613-1-AP) |
| Pankhuri (Verified Customer) (08-19-2022) | I tried this antibody for IF in neural stem cells. It works great in the conc. 1:200. Applications: Immunofluorescence Cell Tissue Type: Progenitor cells Fibronectin Antibody Immunofluorescence validation ( dilution) in Progenitor cells (Cat no:15613-1-AP) |
| Ren Jie (Verified Customer) (07-11-2022) | Very clean bands near 220 kD indicating fibronectin monomer Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Human immortalized mammary fibroblasts Fibronectin Antibody Western Blot validation (1:1000 dilution) in Human immortalized mammary fibroblasts (Cat no:15613-1-AP) |
| SD (Verified Customer) (07-08-2022) | Good Applications: Western Blot Cell Tissue Type: Fibroblast Fibronectin Antibody Western Blot validation ( dilution) in Fibroblast (Cat no:15613-1-AP) |
| zunyi (Verified Customer) (03-11-2022) | This ab is used for immunohistochemistry on mouse paraffin-embedded sections. Antigen-retrieve, using pH 6.0 citric buffer, was performed prior to staining. Applications: Immunohistochemistry, Immunofluorescence Primary Antibody Dilution: 1:100 Cell Tissue Type: mouse bladder |
| Lindsey (Verified Customer) (05-24-2021) | Works beautifully! Looking forward to working more with this antibody in different tissue/prep types Applications: Immunohistochemistry, Immunofluorescence Primary Antibody Dilution: 1:100 Cell Tissue Type: Human kidney (FFPE) Fibronectin Antibody Immunohistochemistry,Immunofluorescence validation (1:100 dilution) in Human kidney (FFPE) (Cat no:15613-1-AP) |
| Citations | 1062 |
| Dilutions | WB : 1:2000-1:20000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF-P : 1:50-1:500 IF/ICC : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Fibronectins play a role in cell adhesion, motility, wound healing, and the maintenance of cell shape. Fibronectins bind to cell surfaces via interactions with integrins and various molecules such as collagen, fibrin, heparin, DNA, and actin (PMID: 3326130). Cellular interaction with fibronectin (FN1) promotes cell cycle progression and proliferation by influencing cyclins. What is the molecular weight of FN1? The molecular weight of FN1 is 220 kDa. What is the tissue specificity of FN1? FN1 is a large glycoprotein that exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1) (PMID: 21923916). Plasma FN1, or the dimeric form, is secreted by hepatocytes, whereas cellular FN1, the dimeric or cross-linked multimeric form, is produced by fibroblasts and epithelial cells and deposited as fibrils in the extracellular matrix. What are the post-translational modifications of FN1? FN1 is often sulfated and its C-terminal NC1 peptide, anastellin, is produced as a result of proteolytic processing and can inhibit tumor growth, angiogenesis, and metastasis by activating p38 MAPK and inhibiting lysophospholipid signaling (PMID: 11209058). What is FN1's role in embryogenesis? Fibronectin has a crucial role in the development of the left-right body axis during embryogenesis (PMID: 21466802). What is FN1's involvement in disease? Fibronectin glomerulopathy is a kidney disease that eventually leads to end-stage renal disease and is caused by mutations in the FN1 gene. Mutations in FN1 lead to the production of abnormal fibronectin protein that is deposited in the glomeruli of the kidney (PMID: 18268355). Protocols Product Specific Protocols FC protocol for Fibronectin antibody 15613-1-AP Download protocol IF protocol for Fibronectin antibody 15613-1-AP Download protocol IHC protocol for Fibronectin antibody 15613-1-AP Download protocol IP protocol for Fibronectin antibody 15613-1-AP Download protocol WB protocol for Fibronectin antibody 15613-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Neonatal Tissue-derived Extracellular Vesicle Therapy (NEXT): A Potent Strategy for Precision Regenerative Medicine
Journal: Adv Mater | Authors: Peng Lou | Species: rat - The phytochemical hyperforin triggers thermogenesis in adipose tissue via a Dlat-AMPK signaling axis to curb obesity.
Journal: Cell Metab | Authors: Suzhen Chen | Species: mouse - Bioengineered platelet nanoplatform enables renal-targeted dexamethasone delivery for chronic nephritis therapy with dual anti-inflammatory/anti-fibrotic effects and minimized systemic toxicity
Journal: Bioact Mater | Authors: Lingling Zhang | Application: WB - Mitochondrial dysfunction in macrophages promotes inflammation and suppresses repair after myocardial infarction
Journal: J Clin Invest | Authors: Shanshan Cai | Species: mouse | Application: IF - Responsive and activable nanomedicines for remodeling the tumor microenvironment.
Journal: Nat Protoc | Authors: Yinlong Zhang | Species: human | Application: WB - Schwann cells regulate tumor cells and cancer-associated fibroblasts in the pancreatic ductal adenocarcinoma microenvironment
Journal: Nat Commun | Authors: Meilin Xue | Species: human
Reviews
Write Your Own Review