STAU2 Polyclonal antibody 15998-1-AP proteintech
$149.00
In stock
SKU
15998-1-AP
| Catalog Number | 15998-1-AP |
| Synonyms | Double-stranded RNA-binding protein Staufen homolog 2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse heart tissue, mouse kidney tissue, mouse brain tissue, mouse liver tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse heart tissue, mouse kidney tissue, mouse brain tissue, mouse liver tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8482 Product name: Recombinant human STAU2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC008370 Sequence: MLQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQR Predict reactive species |
| Full Name | staufen, RNA binding protein, homolog 2 (Drosophila) |
| Calculated Molecular Weight | 570 aa, 62 kDa |
| Observed Molecular Weight | 62-66 kDa |
| GenBank Accession Number | BC008370 |
| Gene Symbol | STAU2 |
| Gene ID (NCBI) | 27067 |
| RRID | AB_10863121 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NUL3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for STAU2 antibody 15998-1-AP | Download protocol |
| WB protocol for STAU2 antibody 15998-1-AP | Download protocol |
| human | WB Nucleic Acids Res Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR. Authors - Evan P Booy View Article |
| mouse | IHC Adv Sci (Weinh) Fine-Tuned Regulation of mRNA Translation and Transport by STAU2 Condensate Facilitates Neuronal Development and Plasticity. Authors - Shijing Huang View Article |
| mouse,human | WB J Biol Chem Staufen2 dysregulation in neurodegenerative disease Authors - Sharan Paul KD Validated View Article |
| Citations | 3 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR.
Journal: Nucleic Acids Res | Authors: Evan P Booy | Species: human | Application: WB - Fine-Tuned Regulation of mRNA Translation and Transport by STAU2 Condensate Facilitates Neuronal Development and Plasticity.
Journal: Adv Sci (Weinh) | Authors: Shijing Huang | Species: mouse | Application: IHC - Staufen2 dysregulation in neurodegenerative disease
Journal: J Biol Chem | Authors: Sharan Paul KD Validated | Species: mouse,human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
