STBD1 Polyclonal antibody 11842-1-AP proteintech
$149.00
In stock
SKU
11842-1-AP
| Catalog Number | 11842-1-AP |
| Synonyms | Genethonin 1, GENEX3414, GENX 3414, starch binding domain 1, STBD1 |
| Host | Rabbit |
| Reactivity | human, mouse and More (2) |
| Reactivity | human, mouse, rat, chicken |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, CoIP, ELISA |
| Applications | WB, IP, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse skeletal muscle tissue, HeLa cells, A549 cells |
| Tested Applications — Positive IP detected in | A549 cells |
| Tested Applications — Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse skeletal muscle tissue, HeLa cells, A549 cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, chicken |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2481 Product name: Recombinant human STBD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-358 aa of BC022301 Sequence: GPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH Predict reactive species |
| Full Name | starch binding domain 1 |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 35-43 kDa |
| GenBank Accession Number | BC022301 |
| Gene Symbol | STBD1 |
| Gene ID (NCBI) | 8987 |
| RRID | AB_2197523 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95210 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for STBD1 antibody 11842-1-AP | Download protocol |
| IP protocol for STBD1 antibody 11842-1-AP | Download protocol |
| WB protocol for STBD1 antibody 11842-1-AP | Download protocol |
| mouse | WB Acta Pharmacol Sin Asiatic acid alleviates ischemic myocardial injury in mice by modulating mitophagy- and glycophagy-based energy metabolism. Authors - Fan Qiu View Article |
| human,mouse | WB,IP Mol Cell Glucose-1-phosphate promotes compartmentalization of glycogen with the pentose phosphate pathway in CD8+ memory T cells Authors - Yabo Zhou View Article |
| Citations | 24 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
STBD1 may have the capability to bind to carbohydrates. It functions as a glycogen receptor that tethers glycogen to autophagic membranes for delivery and breakdown in lysosomes. STBD1 appears molecular mass of 35-38 kDa band in mouse/rat tissues and 38-43 kDa in human tissue. Protocols Product Specific Protocols IHC protocol for STBD1 antibody 11842-1-AP Download protocol IP protocol for STBD1 antibody 11842-1-AP Download protocol WB protocol for STBD1 antibody 11842-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Glycogen accumulation and phase separation drives liver tumor initiation.
Journal: Cell | Authors: Qingxu Liu | Species: mouse | Application: IF - Dysfunction of astrocytic glycophagy exacerbates reperfusion injury in ischemic stroke
Journal: Redox Biol | Authors: Haiyun Guo | Species: human,mouse | Application: WB,IF - Txnrd2 loss in skeletal muscle causes muscle atrophy and drives leanness and obesity resistance.
Journal: Redox Biol | Authors: Claudia Kiermayer | Species: mouse | Application: WB - Glucose-1-phosphate promotes compartmentalization of glycogen with the pentose phosphate pathway in CD8+ memory T cells
Journal: Mol Cell | Authors: Yabo Zhou | Species: human,mouse | Application: WB,IP - Asiatic acid alleviates ischemic myocardial injury in mice by modulating mitophagy- and glycophagy-based energy metabolism.
Journal: Acta Pharmacol Sin | Authors: Fan Qiu | Species: mouse | Application: WB - Glycogen Dynamics Drives Lipid Droplet Biogenesis during Brown Adipocyte Differentiation
Journal: Cell Rep | Authors: Alicia Mayeuf-Louchart - Glycogen Dynamics Drives Lipid Droplet Biogenesis during Brown Adipocyte Differentiation
Journal: Cell Rep | Authors: Alicia Mayeuf-Louchart - Endoplasmic reticulum stress-mediated glycophagy drives macrophage M1 polarization in silica nanoparticles-induced pulmonary fibrosis.
Journal: J Environ Sci (China) | Authors: Lei Bao | Species: mouse | Application: WB,IF,CoIP - Follicle-Stimulating Hormone Alleviates Ovarian Aging by Modulating Mitophagy- and Glycophagy-Based Energy Metabolism in Hens
Journal: Cells | Authors: Juan Dong | Species: chicken | Application: WB,IP - Mitochondrial protein import stress causes lysosomal damage and progressive tissue atrophy.
Journal: EMBO Rep | Authors: Nicholas A Brennan | Species: mouse | Application: WB - Defect in degradation of glycogenin-exposed residual glycogen in lysosomes is the fundamental pathomechanism of Pompe disease
Journal: J Pathol | Authors: Na Zhang | Species: human | Application: IHC,IF - Stbd1 promotes glycogen clustering during endoplasmic reticulum stress and supports survival of mouse myoblasts
Journal: J Cell Sci | Authors: Andria A. Lytridou | Species: mouse | Application: WB,IF - Defective liver glycogen autophagy related to hyperinsulinemia in intrauterine growth-restricted newborn wistar rats.
Journal: Sci Rep | Authors: Juan de Toro-Martín | Species: rat | Application: WB - Transgenic muscle specific Nor-1 expression regulates multiple pathways that effect adiposity, metabolism and endurance.
Journal: Mol Endocrinol | Authors: Pearen Michael A MA | Species: mouse | Application: WB - Chemical genetic screen identifies Gapex-5/GAPVD1 and STBD1 as novel AMPK substrates.
Journal: Cell Signal | Authors: Serge Ducommun | Species: mouse | Application: WB - Starch binding domain-containing protein 1/genethonin 1 is a novel participant in glycogen metabolism.
Journal: J Biol Chem | Authors: Jiang Sixin S | Species: mouse,rat | Application: IF,IP - Starch Binding Domain-containing Protein 1 Plays a Dominant Role in Glycogen Transport to Lysosomes in Liver.
Journal: J Biol Chem | Authors: Tao Sun | Species: mouse | Application: WB - Mouse Stbd1 is N-myristoylated and affects ER-mitochondria association and mitochondrial morphology.
Journal: J Cell Sci | Authors: Anthi Demetriadou | Application: WB,IF - Stbd1 promotes glycogen clustering during endoplasmic reticulum stress and supports survival of mouse myoblasts.
Journal: J Cell Sci | Authors: Andria A Lytridou | Species: mouse | Application: WB,IF - Mouse Stbd1 is N-myristoylated and affects ER-mitochondria association and mitochondrial morphology.
Journal: J Cell Sci | Authors: Anthi Demetriadou | Application: WB,IF - Increased Glycogenin-Exposed Residual Glycogen in Lysosomes Is the Early Pathological Finding in Asymptomatic Pompe Disease.
Journal: Muscle Nerve | Authors: Yixin Shi | Species: human,mouse | Application: WB,IHC - Differential regulation of hepatic macrophage fate by Chi3l1 in metabolic dysfunction-associated steatotic liver disease.
Journal: Elife | Authors: Jia He | Species: mouse | Application: IF - Common and distinct roles of AMPKγ isoforms in small-molecule activator-stimulated glucose uptake in mouse skeletal muscle.
Journal: Mol Metab | Authors: Dipsikha Biswas - Rab4b controls hepatic glucose production during fasting through glycophagy.
Journal: Nat Commun | Authors: Marion Dussot
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
