STEAP3 Polyclonal antibody 28478-1-AP proteintech
$149.00
In stock
SKU
28478-1-AP
| Catalog Number | 28478-1-AP |
| Synonyms | dudlin 2, Dudulin 2, hpHyde, hTSAP6, Metalloreductase STEAP3, pHyde, STEAP family member 3, STEAP3, STMP3, TSAP6 |
| Host | Rabbit |
| Reactivity | Human, mouse, rat and More (3) |
| Reactivity | human, mouse, rat, pig, bovine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, PC-12 cells, C6 cells, mouse liver tissue, rat liver tissue |
| Tested Applications — Positive IHC detected in | human appendicitis tissue, mouse liver tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HeLa cells, PC-12 cells, C6 cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | human appendicitis tissue, mouse liver tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:1000-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | Human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, bovine |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29528 Product name: Recombinant human STEAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-130 aa of BC042150 Sequence: NPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNA Predict reactive species |
| Full Name | STEAP family member 3 |
| Calculated Molecular Weight | 488 aa, 55 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC042150 |
| Gene Symbol | STEAP3 |
| Gene ID (NCBI) | 55240 |
| RRID | AB_3086055 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q658P3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for STEAP3 antibody 28478-1-AP | Download protocol |
| IHC protocol for STEAP3 antibody 28478-1-AP | Download protocol |
| WB protocol for STEAP3 antibody 28478-1-AP | Download protocol |
| mouse | WB FASEB J Prolonged tamoxifen treatment induces iron deposition and ferroptosis in the liver Authors - Jianxin Yang View Article |
| human | IHC BMC Pulm Med PCR array analysis reveals a novel expression profile of ferroptosis-related genes in idiopathic pulmonary fibrosis Authors - Chenyou Shen View Article |
| Citations | 10 |
| Dilutions | WB : 1:1000-1:2000 IHC : 1:500-1:2000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
STEAP3 (Six-Transmembrane Epithelial Antigen of Prostate 3) is also named as TSAP6, Dudulin-2 and pHyde, and belongs to the STEAP family. STEAP3 is a member of the STEAP family and is composed of a six-transmembrane domain at the COOH-terminal domain and a cytoplasmic N-terminal oxidoreductase domain, which is essential for iron and copper uptake (PMID:16227996). STEAP3 contains a functional p53-binding site in its promoter and can be upregulated following p53 activation to enhance cell death in myeloid leukemia cell line and breast cancer cells (PMID: 18617898). By interacting with Nix, a pro-apoptotic Bcl-2 family member, and Myt1 kinase, a negative regulator of the G2/M transition, STEAP3 overexpression promotes apoptosis and inhibits G2/M transition in cell cycle progression (PMID: 12606722, PMID: 10504341). Protocols Product Specific Protocols IF protocol for STEAP3 antibody 28478-1-AP Download protocol IHC protocol for STEAP3 antibody 28478-1-AP Download protocol WB protocol for STEAP3 antibody 28478-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Prolonged tamoxifen treatment induces iron deposition and ferroptosis in the liver
Journal: FASEB J | Authors: Jianxin Yang | Species: mouse | Application: WB - 5-Aminolevulinic Acid photodynamic therapy treats HPV-associated diseases by promoting M1 macrophage polarization through STEAP3/p53/SLC7A11-mediated ferroptosis.
Journal: Photodiagnosis Photodyn Ther | Authors: Rui Xu | Species: human | Application: WB - DMAMCL induces ferroptosis in neuroblastoma by targeting HMOX1 in MYCN-amplified subtypes whereas targeting STEAP3 in MYCN-nonamplified subtypes.
Journal: Redox Rep | Authors: Yifan Ma - TFAP2C-mediated transcriptional activation of STEAP3 promotes lung squamous cell carcinoma progression by regulating the β-catenin pathway
Journal: Biol Direct | Authors: Tong Sun | Species: human | Application: WB,IHC - PCR array analysis reveals a novel expression profile of ferroptosis-related genes in idiopathic pulmonary fibrosis
Journal: BMC Pulm Med | Authors: Chenyou Shen | Species: human | Application: IHC - Sequential release of N-butylphthalide via multifunctional hydrogel for rapid neuroprotection and sustained neural repair after traumatic brain injury.
Journal: Mater Today Bio | Authors: Changbin Hu - Heat shock protein B1-mediated ferroptosis regulates mitochondrial dysfunction in adipose tissue of ketotic dairy cows
Journal: J Dairy Sci | Authors: Yunhui Fan | Species: bovine | Application: WB - Prolonged tamoxifen treatment induces iron deposition and ferroptosis in the liver
Journal: FASEB J | Authors: Jianxin Yang | Species: mouse | Application: WB - PCR array analysis reveals a novel expression profile of ferroptosis-related genes in idiopathic pulmonary fibrosis
Journal: BMC Pulm Med | Authors: Chenyou Shen | Species: human | Application: IHC - 5-Aminolevulinic Acid photodynamic therapy treats HPV-associated diseases by promoting M1 macrophage polarization through STEAP3/p53/SLC7A11-mediated ferroptosis.
Journal: Photodiagnosis Photodyn Ther | Authors: Rui Xu | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
