STK39 Recombinant monoclonal antibody, PBS Only (Capture) 83081-2-PBS proteintech
$699.00
In stock
SKU
83081-2-PBS
| Catalog Number | 83081-2-PBS |
| Synonyms | 230382G9, DCHT, PASK, SPAK, Ste 20 related kinase |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IF/ICC, IF-P, Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag34503 Product name: Recombinant human STK39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 396-455 aa of BC166614 Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV Predict reactive species |
| Full Name | serine threonine kinase 39 (STE20/SPS1 homolog, yeast) |
| Calculated Molecular Weight | 59 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC166614 |
| Gene Symbol | STK39 |
| Gene ID (NCBI) | 27347 |
| RRID | AB_3670797 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UEW8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230382G9 |
| Conjugation | Unconjugated |
STK39 (Serine/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
