SUCNR1/GPR91 Polyclonal antibody 31987-1-AP proteintech
$149.00
In stock
SKU
31987-1-AP
| Catalog Number | 31987-1-AP |
| Synonyms | SUCNR1, G protein coupled receptor 91, GPR91, G-protein coupled receptor 91, P2Y purinoceptor 1 like |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | mouse kidney tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | mouse kidney tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag34053 Product name: Recombinant human SUCNR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-334 aa of BC030948 Sequence: PLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK Predict reactive species |
| Full Name | succinate receptor 1 |
| GenBank Accession Number | BC030948 |
| Gene Symbol | SUCNR1 |
| Gene ID (NCBI) | 56670 |
| RRID | AB_3742507 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9BXA5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for SUCNR1/GPR91 antibody 31987-1-AP | Download protocol |
| mouse | WB Gut Microbes Fusobacterium nucleatum-derived succinic acid aggravates colitis by triggering macrophage pro-inflammatory phenotypic transformation via SUCNR1/NF-κB axis. Authors - Suqi Zeng View Article |
| Citations | 1 |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SUCNR1 (Succinate Receptor 1), also known as GPR91, belongs to the family of G protein-coupled receptors (GPCRs) (PMID: 26808164). SUCNR1 has been identified as a receptor for the metabolite succinate, which functions as a metabolic stress signal in various tissues, including the liver, kidney, adipose tissue, and retina (PMID: 29968758). SUCNR1 is crucial in linking metabolic stress, inflammation, and energy homeostasis. It mediates signaling through Gq/GNAQ or Gi/GNAI second messengers, depending on the cell type and regulated processes. Protocols Product Specific Protocols IHC protocol for SUCNR1/GPR91 antibody 31987-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Fusobacterium nucleatum-derived succinic acid aggravates colitis by triggering macrophage pro-inflammatory phenotypic transformation via SUCNR1/NF-κB axis.
Journal: Gut Microbes | Authors: Suqi Zeng | Species: mouse | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
