SUV39H2 Polyclonal antibody 11338-1-AP proteintech
$149.00
In stock
SKU
11338-1-AP
| Catalog Number | 11338-1-AP |
| Synonyms | H3 K9 HMTase 2, KMT1B, Lysine N methyltransferase 1B, Su(var)3 9 homolog 2, SUV39H2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1882 Product name: Recombinant human SUV39H2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-350 aa of BC007754 Sequence: VKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN Predict reactive species |
| Full Name | suppressor of variegation 3-9 homolog 2 (Drosophila) |
| Calculated Molecular Weight | 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC007754 |
| Gene Symbol | SUV39H2 |
| Gene ID (NCBI) | 79723 |
| RRID | AB_2196730 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H5I1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for SUV39H2 antibody 11338-1-AP | Download protocol |
| mouse | WB,IP Nucleic Acids Res DICER regulates the expression of major satellite repeat transcripts and meiotic chromosome segregation during spermatogenesis. Authors - Ram Prakash Yadav View Article |
| human | WB Nucleic Acids Res Alternative splicing regulates the expression of G9A and SUV39H2 methyltransferases, and dramatically changes SUV39H2 functions. Authors - Oriane Mauger View Article |
| Citations | 16 |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Requirements for establishment and epigenetic stability of mammalian heterochromatin
Journal: Mol Cell | Authors: Antonis Tatarakis KD Validated | Species: mouse | Application: WB - ATM, KAP1 and the Epstein-Barr virus polymerase processivity factor direct traffic at the intersection of transcription and replication
Journal: Nucleic Acids Res | Authors: Huanzhou Xu - The histone methyltransferase Suv39h2 contributes to nonalcoholic steatohepatitis in mice.
Journal: Hepatology | Authors: Zhiwen Fan KO Validated | Species: mouse | Application: WB - Lysine methylation of PPP1CA by the methyltransferase SUV39H2 disrupts TFEB-dependent autophagy and promotes intervertebral disc degeneration
Journal: Cell Death Differ | Authors: Huaizhen Liang | Species: human | Application: WB,IHC,IP - DICER regulates the expression of major satellite repeat transcripts and meiotic chromosome segregation during spermatogenesis.
Journal: Nucleic Acids Res | Authors: Ram Prakash Yadav | Species: mouse | Application: WB,IP - Alternative splicing regulates the expression of G9A and SUV39H2 methyltransferases, and dramatically changes SUV39H2 functions.
Journal: Nucleic Acids Res | Authors: Oriane Mauger | Species: human | Application: WB - DICER regulates the expression of major satellite repeat transcripts and meiotic chromosome segregation during spermatogenesis.
Journal: Nucleic Acids Res | Authors: Ram Prakash Yadav | Species: mouse | Application: WB,IP - The ZBTB24-CDCA7-HELLS axis suppresses the totipotent 2C-like reprogramming by maintaining Dux methylation and repression
Journal: Nucleic Acids Res | Authors: Dan Guo | Species: mouse | Application: WB - N<sup>6</sup> -Methyladenosine-Modified CBX1 Regulates Nasopharyngeal Carcinoma Progression Through Heterochromatin Formation and STAT1 Activation
Journal: Adv Sci (Weinh) | Authors: Yin Zhao | Species: human | Application: WB - KDM4A Erases the H3R17me2a Mark, Facilitating Chromosome Condensation.
Journal: Adv Sci (Weinh) | Authors: Yena Cho | Species: mouse | Application: WB,IP,IF - Lysine methylation of PPP1CA by the methyltransferase SUV39H2 disrupts TFEB-dependent autophagy and promotes intervertebral disc degeneration
Journal: Cell Death Differ | Authors: Huaizhen Liang | Species: human | Application: WB,IHC,IP - Salvia-Nelumbinis naturalis improves lipid metabolism of NAFLD by regulating the SIRT1/AMPK signaling pathway
Journal: BMC Complement Med Ther | Authors: Yang Liu | Species: mouse | Application: WB - Inhibition of protein kinase C increases Prdm14 level to promote self-renewal of embryonic stem cells through reducing Suv39h-induced H3K9 methylation
Journal: J Biol Chem | Authors: Junxiang Ji | Species: mouse | Application: WB - Role of SUV39H2 in shaping the malignant phenotype of triple-negative breast cancer.
Journal: Front Oncol | Authors: Zhi-Wen Wang | Species: human | Application: WB - SUV39H2 is a vulnerability in glioblastoma stem cells enhanced by co-targeting SUV39H1.
Journal: Epigenomics | Authors: Bihui Cao | Species: human | Application: WB - Suv39h2 deficiency ameliorates diet-induced steatosis in mice.
Journal: Biochem Biophys Res Commun | Authors: Jing Shao | Species: mouse | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
