SYNGR4 Polyclonal antibody 21751-1-AP proteintech
$149.00
In stock
SKU
21751-1-AP
| Catalog Number | 21751-1-AP |
| Synonyms | Synaptogyrin-4 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse testis tissue, rat testis tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | mouse testis tissue, rat testis tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag15865 Product name: Recombinant human SYNGR4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 155-234 aa of BC106891 Sequence: LVWIFQAYLAFQDLRNDAPVPYKRFLDEGGMVLTTLPLPSANSPVNMPTTGPNSLSYASSALSPCLTAPKSPRLAMMPDN Predict reactive species |
| Full Name | synaptogyrin 4 |
| Calculated Molecular Weight | 234 aa, 26 kDa |
| Observed Molecular Weight | 22-25 kDa |
| GenBank Accession Number | BC106891 |
| Gene Symbol | SYNGR4 |
| Gene ID (NCBI) | 23546 |
| RRID | AB_10860264 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95473 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for SYNGR4 antibody 21751-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
