ChromoTek anti-Strep recombinant VHH, unconjugated qt proteintech
$383.00
In stock
SKU
qt
| Synonyms | Strep Tag Nanobody, anti-SAWSHPQFEK VHH |
| Host | Alpaca |
| Molecular Weight | 15 kDa |
| Formulation | United States |
| Applications | Suitable for conjugation to beads, plates, and surfaces via NHS-chemistry |
| Host / Isotype | Conjugation |
| Specificity/Target | Binds specifically to the peptide sequence SAWSHPQFEK, also known as Strep-Tag® or Strep-TagII®, fused to a protein of interest at N- or C-terminal position. In addition, this VHH binds to the peptide sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, also known as Twin-Strep-Tag®, fused to a protein of interest at N- or C-terminal position. |
| Conjugate | Unconjugated |
| Type | Nanobody |
| Class | Recombinant |
| Affinity (K D ) | 480 nM for N-terminal Strep-Tag® and 600 nM for C-terminal Strep-Tag® |
| RRID | AB_3107052 |
| Storage Buffer | 25 mM TAPS pH 8.5, 500 mM NaCl, 5 mM EDTA, preservative: 0.09% sodium azide |
| Storage Condition | Shipped at ambient temperature. Upon receipt store at +4°C. Stable for one year. Do not freeze! |
| Size | 250 µg |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
