Syntenin-1 Recombinant monoclonal antibody 86968-1-RR proteintech
$149.00
In stock
SKU
86968-1-RR
| Catalog Number | 86968-1-RR |
| Synonyms | SDCBP, MDA 9, MDA9, MDA-9, Melanoma differentiation-associated protein 9 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, A549 cells, U2OS cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, A549 cells, U2OS cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag18078 Product name: Recombinant human SDCBP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 12-139 aa of BC113674 Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ Predict reactive species |
| Full Name | syndecan binding protein (syntenin) |
| Calculated Molecular Weight | 298 aa, 32 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC113674 |
| Gene Symbol | Syntenin-1 |
| Gene ID (NCBI) | 6386 |
| RRID | AB_3745240 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O00560 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Syntenin-1 antibody 86968-1-RR | Download protocol |
| IHC protocol for Syntenin-1 antibody 86968-1-RR | Download protocol |
| IP protocol for Syntenin-1 antibody 86968-1-RR | Download protocol |
| WB protocol for Syntenin-1 antibody 86968-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:10000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 252107H1 |
| Conjugation | Unconjugated |
Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Protocols Product Specific Protocols IF protocol for Syntenin-1 antibody 86968-1-RR Download protocol IHC protocol for Syntenin-1 antibody 86968-1-RR Download protocol IP protocol for Syntenin-1 antibody 86968-1-RR Download protocol WB protocol for Syntenin-1 antibody 86968-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
