VAPB Polyclonal antibody 14477-1-AP proteintech
$149.00
In stock
SKU
14477-1-AP
| Catalog Number | 14477-1-AP |
| Synonyms | ALS8, UNQ484/PRO983, VAMP associated protein B/C, VAMP B, VAMP B/VAMP C |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (2) |
| Reactivity | human, mouse, rat, monkey, zebrafish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, mouse brain tissue, mouse liver tissue, rat liver tissue |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue, human pancreas cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells, HepG2 cells, U2OS cells |
| Tested Applications — Positive FC (Intra) detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, mouse brain tissue, mouse liver tissue, rat liver tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human pancreas cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells, U2OS cells |
| Positive FC (Intra) detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, zebrafish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag5857 Product name: Recombinant human VAPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-180 aa of BC001712 Sequence: KLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV Predict reactive species |
| Full Name | VAMP (vesicle-associated membrane protein)-associated protein B and C |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC001712 |
| Gene Symbol | VAPB |
| Gene ID (NCBI) | 9217 |
| RRID | AB_2288297 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95292 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for VAPB antibody 14477-1-AP | Download protocol |
| IF protocol for VAPB antibody 14477-1-AP | Download protocol |
| IHC protocol for VAPB antibody 14477-1-AP | Download protocol |
| IP protocol for VAPB antibody 14477-1-AP | Download protocol |
| WB protocol for VAPB antibody 14477-1-AP | Download protocol |
| human | WB,IP Nat Microbiol Toxoplasma effector TgROP1 establishes membrane contact sites with the endoplasmic reticulum during infection. Authors - Chahat Mehra View Article |
| monkey | WB Nat Cell Biol MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control. Authors - Tim König View Article |
| mouse | WB,IHC Mol Neurodegener Widespread aggregation of mutant VAPB associated with ALS does not cause motor neuron degeneration or modulate mutant SOD1 aggregation and toxicity in mice. Authors - Qiu Linghua L View Article |
| Miriam (Verified Customer) (12-03-2025) | Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: U2OS VAPB Antibody Western Blot validation (1:1000 dilution) in U2OS (Cat no:14477-1-AP) |
| Wei (Verified Customer) (09-22-2020) | The antibody have predicted band on western blot. Applications: Western Blot Cell Tissue Type: Mouse heart |
| Citations | 77 |
| Dilutions | WB : 1:2000-1:12000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:400-1:1600 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Vesicle-associated membrane protein-associated protein B (VAPB) is an integral membrane protein localized to the endoplasmic reticulum (ER) membrane. VAPB has been implicated in various cellular processes, including ER stress, the unfolded protein response (UPR) and calcium homeostasis regulation. The mutations in the gene of VAPB cause amyotrophic lateral sclerosis 8 (ALS8) and some other related forms of motor neuron disease including late-onset spinal muscular atrophy. Protocols Product Specific Protocols FC protocol for VAPB antibody 14477-1-AP Download protocol IF protocol for VAPB antibody 14477-1-AP Download protocol IHC protocol for VAPB antibody 14477-1-AP Download protocol IP protocol for VAPB antibody 14477-1-AP Download protocol WB protocol for VAPB antibody 14477-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- A High-Density Human Mitochondrial Proximity Interaction Network.
Journal: Cell Metab | Authors: Hana Antonicka | Species: human | Application: WB - DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.
Journal: Cell Res | Authors: Pengli Zheng | Species: human | Application: WB - MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control.
Journal: Nat Cell Biol | Authors: Tim König | Species: monkey | Application: WB - Proteomic mapping and targeting of mitotic pericentriolar material in tumors bearing centrosome amplification.
Journal: Cancer Res | Authors: Bingteng Xie | Species: human | Application: IF - Widespread aggregation of mutant VAPB associated with ALS does not cause motor neuron degeneration or modulate mutant SOD1 aggregation and toxicity in mice.
Journal: Mol Neurodegener | Authors: Qiu Linghua L | Species: mouse | Application: WB,IHC - Toxoplasma effector TgROP1 establishes membrane contact sites with the endoplasmic reticulum during infection.
Journal: Nat Microbiol | Authors: Chahat Mehra | Species: human | Application: WB,IP - Organelle contact reorganization drives calcium-dependent autophagy under proteostatic stress.
Journal: Autophagy | Authors: Yu bin Ko | Species: human | Application: IF - USP20 deubiquitinates and stabilizes the reticulophagy receptor RETREG1/FAM134B to drive reticulophagy
Journal: Autophagy | Authors: Man Zhang | Species: human | Application: WB - Sec14L6 is a phosphoinositide transporter that regulates phosphoinositide homeostasis and biogenesis of lipid droplets
Journal: Nat Commun | Authors: Tiantian Zhou | Application: WB - Bipolar and schizophrenia risk gene AKAP11 encodes an autophagy receptor coupling the regulation of PKA kinase network homeostasis to synaptic transmission.
Journal: Nat Commun | Authors: You-Kyung Lee | Species: mouse | Application: WB,IHC - The p97-UBXD8 complex regulates ER-Mitochondria contact sites by altering membrane lipid saturation and composition
Journal: Nat Commun | Authors: Rakesh Ganji | Species: human | Application: WB - Elevated synaptic PKA activity and abnormal striatal dopamine signaling in Akap11 mutant mice, a genetic model of schizophrenia and bipolar disorder.
Journal: Nat Commun | Authors: Bryan J. Song | Species: mouse | Application: WB,IP - Elevated synaptic PKA activity and abnormal striatal dopamine signaling in Akap11 mutant mice, a genetic model of schizophrenia and bipolar disorder.
Journal: Nat Commun | Authors: Bryan J. Song | Species: mouse | Application: WB,IP - Fluorescent fatty acid conjugates for live cell imaging of peroxisomes
Journal: Nat Commun | Authors: Daria Korotkova | Species: human | Application: WB - Sec14L6 is a phosphoinositide transporter that regulates phosphoinositide homeostasis and biogenesis of lipid droplets
Journal: Nat Commun | Authors: Tiantian Zhou | Application: WB - MIGA2 Links Mitochondria, the ER, and Lipid Droplets and Promotes De Novo Lipogenesis in Adipocytes.
Journal: Mol Cell | Authors: Christophe A C Freyre | Species: monkey | Application: WB - CGI1746 targets σ1R to modulate ferroptosis through mitochondria-associated membranes
Journal: Nat Chem Biol | Authors: Zili Zhang | Species: human | Application: WB - Phenylalanine deprivation inhibits multiple myeloma progression by perturbing endoplasmic reticulum homeostasis
Journal: Acta Pharm Sin B | Authors: Longhao Cheng | Species: human | Application: WB - SPTLC1 variants associated with ALS produce distinct sphingolipid signatures through impaired interaction with ORMDL proteins.
Journal: J Clin Invest | Authors: Museer A Lone | Species: human | Application: WB - VAPB is a negative regulator of STING-mediated innate immune signaling.
Journal: Sci Adv | Authors: Wangsheng Ji | Species: human, mouse | Application: WB,IP,IF - Oligomeric CHMP7 mediates three-way ER junctions and ER-mitochondria interactions
Journal: Cell Death Differ | Authors: Qingzhu Chu | Species: human | Application: WB - Pathological convergence of APP and SNCA deficiency in hippocampal degeneration of young rats
Journal: Cell Death Dis | Authors: Yajie Wang | Species: rat | Application: WB - Fluoride induces spermatocyte apoptosis by IP3R1/MCU-mediated mitochondrial calcium overload through MAMs
Journal: J Hazard Mater | Authors: Xin Guo | Species: human | Application: WB - Deregulation of ER-mitochondria contact formation and mitochondrial calcium homeostasis mediated by VDAC in fragile X syndrome
Journal: Dev Cell | Authors: Ji Geng | Species: mouse | Application: WB - GRP75-dependent mitochondria-ER contacts ensure cell survival during early mouse thymocyte development
Journal: Dev Cell | Authors: Fan Zhao | Species: mouse | Application: WB - FAM134B-mediated ER-phagy alleviates alcohol-related liver fibrosis by reducing endoplasmic reticulum stress
Journal: Int J Biol Macromol | Authors: Tiantian Wang | Species: mouse | Application: WB - Changes in the endoplasmic reticulum‑mitochondria communication in dermal fibroblasts from early‑stage bipolar disorder patients: Skin‑brain axis as a new route to understand the pathophysiology of mental illness?
Journal: Int J Mol Med | Authors: ANA CATARINA PEREIRA | Species: human | Application: WB - Deficiency of Perry syndrome-associated p150Glued in midbrain dopaminergic neurons leads to progressive neurodegeneration and endoplasmic reticulum abnormalities
Journal: NPJ Parkinsons Dis | Authors: Jia Yu | Species: mouse | Application: WB - Convergent activation of the integrated stress response and ER-mitochondria uncoupling in VAPB-associated ALS
Journal: EMBO Mol Med | Authors: Curran Landry | Species: human | Application: WB - ER-endosome contacts generate a local environment promoting phagophore formation
Journal: Cell Rep | Authors: Juliane Da Graça | Species: human | Application: IF - Neurons and astrocytes have distinct organelle signatures and responses to stress.
Journal: Cell Rep | Authors: Shannon N. Rhoads | Species: rat | Application: WB - Loss of VAPB Regulates Autophagy in a Beclin 1-Dependent Manner.
Journal: Neurosci Bull | Authors: Dan Wu | Species: human | Application: WB,IF - Bridging the gap: investigating the role of phosphorylation at the serine 129 site of α-synuclein in VAPB-PTPIP51 interactions
Journal: Acta Neuropathol Commun | Authors: Weijin Liu | Species: mouse,human | Application: WB,CoIP - The ATF6 pathway of the ER stress response contributes to enhanced viability in glioblastoma.
Journal: Oncotarget | Authors: David Y A Dadey | Species: human | Application: WB - Rickettsia parkeri forms extensive, stable contacts with the rough endoplasmic reticulum.
Journal: J Cell Biol | Authors: Yamilex Acevedo-Sánchez | Species: human | Application: IF - The p97 ATPase and its adaptor UBXD8 maintain peroxisome pools by preventing pexophagy.
Journal: J Cell Biol | Authors: Iris D. Montes - The p97 ATPase and its adaptor UBXD8 maintain peroxisome pools by preventing pexophagy.
Journal: J Cell Biol | Authors: Iris D. Montes - Rickettsia parkeri forms extensive, stable contacts with the rough endoplasmic reticulum.
Journal: J Cell Biol | Authors: Yamilex Acevedo-Sánchez | Species: human | Application: IF - ARTC1-mediated VAPB ADP-ribosylation regulates calcium homeostasis
Journal: J Mol Cell Biol | Authors: Xueyao Ma | Species: human | Application: WB,IF,CoIP - ER-mitochondria contacts and cholesterol metabolism are disrupted by disease-associated tau protein
Journal: EMBO Rep | Authors: Leonora Szabo | Species: human | Application: IF - Mobile late endosomes modulate peripheral endoplasmic reticulum network architecture.
Journal: EMBO Rep | Authors: Menno Spits | Application: IF - Peri-mitochondrial actin filaments inhibit Parkin assembly by disrupting ER-mitochondria contacts
Journal: EMBO Rep | Authors: Tak Shun Fung | Species: human | Application: WB - A novel bacterial effector protein mediates ER-LD membrane contacts to regulate host lipid droplets
Journal: EMBO Rep | Authors: Rajendra Kumar Angara | Species: human | Application: WB,IF - Neuronal overexpression of human VAPB slows motor impairment and neuromuscular denervation in a mouse model of ALS.
Journal: Hum Mol Genet | Authors: Ji-Yoen Kim | Species: mouse | Application: WB,IF - The Novel ALG-2 Target Protein CDIP1 Promotes Cell Death by Interacting with ESCRT-I and VAPA/B.
Journal: Int J Mol Sci | Authors: Ryuta Inukai | Species: human | Application: WB,IP - Elucidation of OSW-1-Induced Stress Responses in Neuro2a Cells
Journal: Int J Mol Sci | Authors: Kentaro Oh-Hashi | Species: mouse | Application: WB - Fasting Enhances Cardiomyocyte Hypoxia Tolerance by Regulating Ca(2+) Transport at Mitochondria-Endoplasmic Reticulum Contact Sites.
Journal: Int J Mol Sci | Authors: Xiangning Chen | Species: rat | Application: IF - Elevating VAPB-PTPIP51 integration repairs damaged mitochondria-associated endoplasmic reticulum membranes and inhibits lung fibroblasts activation
Journal: Int Immunopharmacol | Authors: Jiaqi Ban | Species: mouse | Application: WB,IF - Serine-129 phosphorylated α-synuclein drives mitochondrial dysfunction and calcium dysregulation in Parkinson's disease model
Journal: Front Aging Neurosci | Authors: Jie Jiao | Species: mouse,human | Application: WB,IF - Particulate matter induced cognitive impairments via endoplasmic reticulum stress-mediated damage to mitochondria-associated endoplasmic reticulum membranes in immature rats
Journal: Toxicology | Authors: Lingman Wang | Species: rat | Application: WB - Proteomics-Based Approach Identifies Altered ER Domain Properties by ALS-Linked VAPB Mutation.
Journal: Sci Rep | Authors: Tomoyuki Yamanaka | Species: mouse | Application: WB,IP - Development of a Signal-integrating Reporter to Monitor Mitochondria-ER Contacts
Journal: ACS Synth Biol | Authors: Zheng Yang | Species: human | Application: IF - Expression of vesicle-associated membrane-protein-associated protein B cleavage products in peripheral blood leukocytes and cerebrospinal fluid of patients with sporadic amyotrophic lateral sclerosis.
Journal: Eur J Neurol | Authors: I Deidda | Species: human | Application: WB - ALS-Linked VapB P56S Mutation Alters Neuronal Mitochondrial Turnover at the Synapse
Journal: J Neurosci | Authors: Hiu-Tung C Wong | Species: zebrafish | Application: WB - Nir2 Is an Effector of VAPs Necessary for Efficient Hepatitis C Virus Replication and Phosphatidylinositol 4-Phosphate Enrichment at the Viral Replication Organelle.
Journal: J Virol | Authors: Hongliang Wang | Species: human | Application: WB - Adenovirus Modulates Toll-Like Receptor 4 Signaling by Reprogramming ORP1L-VAP Protein Contacts for Cholesterol Transport from Endosomes to the Endoplasmic Reticulum.
Journal: J Virol | Authors: Nicholas L Cianciola - Long-chain acyl-CoA synthetase 1 interacts with key proteins that activate and direct fatty acids into niche hepatic pathways.
Journal: J Biol Chem | Authors: Pamela A Young | Species: mouse | Application: WB - The role of Mfn2 in the structure and function of endoplasmic reticulum-mitochondrial tethering in vivo.
Journal: J Cell Sci | Authors: Song Han | Species: human | Application: WB - Tail Anchored protein insertion mediated by CAML and TRC40 links to neuromuscular function in mice
Journal: PLoS Genet | Authors: Ying Zhang | Species: mouse | Application: WB - Ribosome-binding protein 1 maintains peroxisome biogenesis.
Journal: J Cell Sci | Authors: Kaneez Fatima | Species: human | Application: WB - Ribosome-binding protein 1 maintains peroxisome biogenesis.
Journal: J Cell Sci | Authors: Kaneez Fatima | Species: human | Application: WB - Electroacupuncture Regulates Mitochondria-Endoplasmic Reticulum interactions via Fn1 in a Parkinson's Disease Model: Transcriptomic Evidence.
Journal: J Integr Neurosci | Authors: Peilin Lyu | Species: mouse | Application: WB - Disease mutations in Rab7 result in unregulated nucleotide exchange and inappropriate activation.
Journal: Hum Mol Genet | Authors: McCray Brett A BA | Species: human | Application: WB - A SNX1–SNX2–VAPB partnership regulates endosomal membrane rewiring in response to nutritional stress
Journal: Life Sci Alliance | Authors: Juliane Da Graça | Species: human | Application: IF - Serine palmitoyltransferase assembles at ER-mitochondria contact sites.
Journal: Life Sci Alliance | Authors: Mari J Aaltonen - Neuronal overexpression of human VAPB slows motor impairment and neuromuscular denervation in a mouse model of ALS.
Journal: Hum Mol Genet | Authors: Ji-Yoen Kim | Species: mouse | Application: WB,IF - VPS13D interacts with VCP/p97 and negatively regulates ER- mitochondrial interactions.
Journal: Mol Biol Cell | Authors: Yuanjiao Du | Species: human | Application: WB，IF - The role of ER-related BiP/GRP78 in IFN-γ induced persistent Chlamydia pneumoniae infection.
Journal: Cell Microbiol | Authors: Kensuke Shima | Species: human | Application: IF - Development of a signal-integrating reporter to monitor mitochondria-ER contacts
Journal: bioRxiv | Authors: Zheng Yang | Species: human | Application: IF - Mitochondrial dysfunction heightens the integrated stress response to drive ALS pathogenesis.
Journal: bioRxiv | Authors: Curran Landry | Species: human | Application: WB,IP - The p97-UBXD8 complex maintains peroxisome abundance by suppressing pexophagy
Journal: bioRxiv | Authors: Iris D Montes | Species: human | Application: WB - Pathogenic mechanisms of amyotrophic lateral sclerosis-linked VAPB P56S mutation in the degeneration of corticospinal motor neurons.
Journal: Ageing Neurodegener Dis | Authors: Xuan Yang - The p97-UBXD8 complex maintains peroxisome abundance by suppressing pexophagy
Journal: bioRxiv | Authors: Iris D Montes | Species: human | Application: WB - Bipolar and schizophrenia risk gene AKAP11 encodes an autophagy receptor coupling the regulation of PKA kinase network homeostasis to synaptic transmission
Journal: Res Sq | Authors: You-Kyung Lee | Species: mouse | Application: WB,IF - Elevated synaptic PKA activity and abnormal striatal dopamine signaling in Akap11 mutant mice, a genetic model of schizophrenia and bipolar disorder.
Journal: bioRxiv | Authors: Bryan J. Song | Species: mouse | Application: WB,IP - Phosphorylation-dependent interaction between VAP proteins and INF2 influences ER morphology.
Journal: Curr Biol | Authors: Frieda Kage - BLTP2 bridges the ER and MVB for exosome biogenesis at SCAMP3-dependent ER contacts.
Journal: Curr Biol | Authors: Jingru Wang
Reviews
Write Your Own Review