AMOTL2 Monoclonal antibody 68401-1-Ig proteintech
$149.00
In stock
SKU
68401-1-Ig
| Catalog Number | 68401-1-Ig |
| Synonyms | AMOTL2, angiomotin like 2, Angiomotin like protein 2, KIAA0989, LCCP, Leman coiled coil protein |
| Host | Mouse |
| Reactivity | Human |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | A549 cells, DU 145 cells, Saos-2 cells, NCI-H1299 cells, MDA-MB-468 cells, SK-BR-3 cells |
| Tested Applications — Positive IF/ICC detected in | A549 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Positive WB detected in | A549 cells, DU 145 cells, Saos-2 cells, NCI-H1299 cells, MDA-MB-468 cells, SK-BR-3 cells |
| Positive IF/ICC detected in | A549 cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Tested Reactivity | Human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag19971 Product name: Recombinant human AMOTL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 340-466 aa of BC011454 Sequence: DPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI Predict reactive species |
| Full Name | angiomotin like 2 |
| Calculated Molecular Weight | 779 aa, 86 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC011454 |
| Gene Symbol | AMOTL2 |
| Gene ID (NCBI) | 51421 |
| RRID | AB_3085118 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9Y2J4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for AMOTL2 antibody 68401-1-Ig | Download protocol |
| WB protocol for AMOTL2 antibody 68401-1-Ig | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:10000 IF/ICC : 1:500-1:2000 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2C4A4 |
| Conjugation | Unconjugated |
Angiomotin‑like 2 (AMOTL2) is a member of the motin family of angiostatin‑binding proteins. The motin family, also known as AMOTs, consists of three members: AMOT, AMOT-like 1 (AMOTL1) and AMOTL2. Members of the motin family are a type of adaptor proteins mainly distributed in the cytomembrane, cytoplasm or nucleus, and have a higher expression in the endothelial cells of capillaries and in larger vessels of the placenta. Human AmotL2 encodes two isoforms of a molecular mass of 100 kDa and 60 kDa.(PMID: 34036399,PMID: 25080976) Protocols Product Specific Protocols IF protocol for AMOTL2 antibody 68401-1-Ig Download protocol WB protocol for AMOTL2 antibody 68401-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
