TBCA Polyclonal antibody 12304-1-AP proteintech
$149.00
In stock
SKU
12304-1-AP
| Catalog Number | 12304-1-AP |
| Synonyms | CFA, TBCA, TCP1 chaperonin cofactor A, tubulin folding cofactor A, Tubulin specific chaperone A |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IP, IF, IHC, ELISA |
| Applications | WB, IP, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human brain tissue, HeLa cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:300-1:1500 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | human brain tissue, HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:300-1:1500 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2950 Product name: Recombinant human TBCA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC018210 Sequence: MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA Predict reactive species |
| Full Name | tubulin folding cofactor A |
| Calculated Molecular Weight | 108 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC018210 |
| Gene Symbol | TBCA |
| Gene ID (NCBI) | 6902 |
| RRID | AB_2199402 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75347 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for TBCA antibody 12304-1-AP | Download protocol |
| IP protocol for TBCA antibody 12304-1-AP | Download protocol |
| WB protocol for TBCA antibody 12304-1-AP | Download protocol |
| human | WB Oncol Rep ERp29 counteracts the suppression of malignancy mediated by endoplasmic reticulum stress and promotes the metastasis of colorectal cancer. Authors - Lili Guo View Article |
| mouse | IF Histochem Cell Biol Spatio-temporal distribution of tubulin-binding cofactors and posttranslational modifications of tubulin in the cochlea of mice. Authors - Lukas Juergens View Article |
| Citations | 4 |
| Dilutions | WB : 1:300-1:1500 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Tubulin cofactor a functions as a novel positive regulator of ccRCC progression, invasion and metastasis.
Journal: Int J Cancer | Authors: Zhang Peng P | Species: human | Application: WB,IHC - Spatio-temporal distribution of tubulin-binding cofactors and posttranslational modifications of tubulin in the cochlea of mice.
Journal: Histochem Cell Biol | Authors: Lukas Juergens | Species: mouse | Application: IF - Target-Sequencing of Female Infertility Pathogenic Gene Panel and a Novel TUBB8 Loss-of-Function Mutation.
Journal: Front Genet | Authors: Hongxia Yuan | Species: human | Application: WB - ERp29 counteracts the suppression of malignancy mediated by endoplasmic reticulum stress and promotes the metastasis of colorectal cancer.
Journal: Oncol Rep | Authors: Lili Guo | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
