TBX18 Polyclonal antibody 23237-1-AP proteintech
$149.00
In stock
SKU
23237-1-AP
| Catalog Number | 23237-1-AP |
| Synonyms | T box 18, T box protein 18, TBX18 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HEK-293 cells, human placenta tissue, mouse kidney tissue, rat kidney tissue |
| Tested Applications — Positive IHC detected in | human kidney tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | HeLa cells, HEK-293 cells, human placenta tissue, mouse kidney tissue, rat kidney tissue |
| Positive IHC detected in | human kidney tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag19258 Product name: Recombinant human TBX18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 350-532 aa of BC157841 Sequence: PSLRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSCPQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGY Predict reactive species |
| Full Name | T-box 18 |
| Calculated Molecular Weight | 607 aa, 65 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC157841 |
| Gene Symbol | TBX18 |
| Gene ID (NCBI) | 9096 |
| RRID | AB_2879237 |
| Conjugate | Unconjugated |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | O95935 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for TBX18 antibody 23237-1-AP | Download protocol |
| WB protocol for TBX18 antibody 23237-1-AP | Download protocol |
| human | IF EBioMedicine E2A ablation enhances proportion of nodal-like cardiomyocytes in cardiac-specific differentiation of human embryonic stem cells. Authors - Xiuya Li View Article |
| rat | WB Mol Med Rep G9a inhibition promotes the formation of pacemaker-like cells by reducing the enrichment of H3K9me2 in the HCN4 promoter region Authors - Pei Xu View Article |
| Citations | 3 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The T-box (Tbx) motif is present in a family of genes whose structural features and expression patterns support their involvement in developmental gene regulation. The Tbx gene family are largely conserved throughout metazoan evolution, and these genes code for putative transcription factors that share a uniquely defining DNA-binding domain. Tbx genes are a family of developmental regulators with more than 20 members recently identified in invertebrates and vertebrates. Mutations in Tbx genes are associated with the onset of several human diseases. Our understanding of functional mechanisms of Tbx products has come mainly from the prototypical T/Brachyury, which is a transcription activator. The Tbx genes constitute a family of transcriptional regulatory genes that are implicated in a variety of developmental processes ranging from the formation of germ layers to the organizational patterning of the central nervous system.This antibody specifically reacts with the 65kd TBX18 protein. Protocols Product Specific Protocols IHC protocol for TBX18 antibody 23237-1-AP Download protocol WB protocol for TBX18 antibody 23237-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- E2A ablation enhances proportion of nodal-like cardiomyocytes in cardiac-specific differentiation of human embryonic stem cells.
Journal: EBioMedicine | Authors: Xiuya Li | Species: human | Application: IF - G9a inhibition promotes the formation of pacemaker-like cells by reducing the enrichment of H3K9me2 in the HCN4 promoter region
Journal: Mol Med Rep | Authors: Pei Xu | Species: rat | Application: WB - The TBX18/SIX1 Transcriptional Circuit Maintains Stemness and EMT States to Promote Radioresistance in ESCC.
Journal: Cancers (Basel) | Authors: Liming Gu
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
