AMPK Beta 1 Polyclonal antibody 26907-1-AP proteintech
$149.00
In stock
SKU
26907-1-AP
| Catalog Number | 26907-1-AP |
| Synonyms | PRKAB1, 5'-AMP-activated protein kinase subunit beta-1, AMPK, AMPK subunit beta 1, AMPK subunit beta-1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A431 cells, Jurkat cells, NIH/3T3 cells, HeLa cells, PC-12 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Positive WB detected in | A431 cells, Jurkat cells, NIH/3T3 cells, HeLa cells, PC-12 cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25534 Product name: Recombinant human PRKAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC001056 Sequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN Predict reactive species |
| Full Name | protein kinase, AMP-activated, beta 1 non-catalytic subunit |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC001056 |
| Gene Symbol | PRKAB1 |
| Gene ID (NCBI) | 5564 |
| RRID | AB_2880679 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y478 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for AMPK Beta 1 antibody 26907-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880). Protocols Product Specific Protocols WB protocol for AMPK Beta 1 antibody 26907-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
