Amylase Alpha Polyclonal antibody 12540-1-AP proteintech
$149.00
In stock
SKU
12540-1-AP
| Catalog Number | 12540-1-AP |
| Synonyms | AMY2B, Amylase, alpha, 1,4-alpha-D-glucan glucanohydrolase 2B, Alpha amylase, Alpha amylase 2B |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse pancreas tissue |
| Tested Applications — Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | rat pancreas tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:20000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Positive WB detected in | mouse pancreas tissue |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat pancreas tissue |
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3260 Product name: Recombinant human AMY2B protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 160-511 aa of BC011179 Sequence: SGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL Predict reactive species |
| Full Name | amylase, alpha 2B (pancreatic) |
| Calculated Molecular Weight | 511 aa, 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC011179 |
| Gene Symbol | AMY2B |
| Gene ID (NCBI) | 280 |
| RRID | AB_2273990 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19961 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Amylase Alpha antibody 12540-1-AP | Download protocol |
| IHC protocol for Amylase Alpha antibody 12540-1-AP | Download protocol |
| WB protocol for Amylase Alpha antibody 12540-1-AP | Download protocol |
| mouse | IF Biomed Pharmacother Serotonin-RhoA/ROCK axis promotes acinar-to-ductal metaplasia in caerulein-induced chronic pancreatitis. Authors - Xufeng Tao View Article |
| Sai Sindhura (Verified Customer) (01-08-2026) | Amylase antibody worked very good. Applications: Western Blot Primary Antibody Dilution: 1:1000 |
| Mounika (Verified Customer) (01-08-2026) | Best and easy to work with, No Hassale! Applications: Western Blot, Immunohistochemistry, Immunofluorescence Primary Antibody Dilution: 1:800 |
| Gabriele (Verified Customer) (07-18-2025) | The antibody works very well both in WB (1:5000, 5% milk) and IF (1:200, 5% BSA) on HEK293T over-expressing human AMY2A 48h post-transfection vs not-treated control Applications: Western Blot, Immunofluorescence Primary Antibody Dilution: WB: 1:5000 - IF: 1:200 Cell Tissue Type: HEK293T Amylase Alpha Antibody Western Blot,Immunofluorescence validation (WB: 1:5000 - IF: 1:200 dilution) in HEK293T (Cat no:12540-1-AP) |
| balawant (Verified Customer) (08-06-2022) | This antibody is working great and need 1:20000 dilution. Applications: Western Blot Primary Antibody Dilution: 1:20000 Cell Tissue Type: Intestinal tissue and colon cancer cell line |
| Susmita (Verified Customer) (06-13-2022) | This is an excellent antibody for IHC and WB application Applications: Western Blot Primary Antibody Dilution: WB: 1: 4000, IHC 1: 400 Cell Tissue Type: PC cell line PC tissue |
| Iram (Verified Customer) (03-11-2022) | Very good antibody for western Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: Colon cancer cells |
| Citations | 26 |
| Dilutions | WB : 1:5000-1:20000 IHC : 1:50-1:500 IF-P : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
AMY2B(alpha-amylase 2B) belongs to the glycosyl hydrolase 13 family. This protein is involved in the endohydrolysis of 1,4-alpha-glucosidic linkages in oligosaccharides and polysaccharides. The full length 58 kDa protein has a signal peptide with 15 amino acids. Human amylases (Amy1, Amy2A, and Amy2B) commonly have two potential N-glycosylation sites (N427 and N476) in their C-terminal region (S Takashima, J Amano, 2012). 12540-1-AP can recognize both AMY2A and AMY2B. Protocols Product Specific Protocols IF protocol for Amylase Alpha antibody 12540-1-AP Download protocol IHC protocol for Amylase Alpha antibody 12540-1-AP Download protocol WB protocol for Amylase Alpha antibody 12540-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Inflammation and Acinar Cell Dual-Targeting Nanomedicines for Synergistic Treatment of Acute Pancreatitis via Ca2+ Homeostasis Regulation and Pancreas Autodigestion Inhibition
Journal: ACS Nano | Authors: Yanan Wang | Species: mouse | Application: IF - SULF2 enhances GDF15-SMAD axis to facilitate the initiation and progression of pancreatic cancer.
Journal: Cancer Lett | Authors: Ruizhe He | Species: mouse | Application: IF - Pyrazole derivative Z10 ameliorates acute pancreatitis by inhibiting the ERK/Ddt pathway
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Wenying Zeng - Gastrodin ameliorates acute pancreatitis by modulating macrophage inflammation cascade via inhibition the p38/NF-κB pathway
Journal: Int Immunopharmacol | Authors: Yalan Jiang | Species: mouse | Application: WB,IHC - Vacuolization of mucolipidosis type II mouse exocrine gland cells represents accumulation of autolysosomes.
Journal: Mol Biol Cell | Authors: Boonen Marielle M | Species: mouse | Application: IHC - Serotonin-RhoA/ROCK axis promotes acinar-to-ductal metaplasia in caerulein-induced chronic pancreatitis.
Journal: Biomed Pharmacother | Authors: Xufeng Tao | Species: mouse | Application: IF - Tailored "Three-stage booster" nano-extinguisher for synergistic treatment of severe acute pancreatitis by rectifying mitochondrial dysfunction and inhibiting pancreatic autodigestion
Journal: Acta Biomater | Authors: Jiahui Yan | Species: mouse | Application: IF - hP-MSCs attenuate severe acute pancreatitis in mice via inhibiting NLRP3 inflammasome-mediated acinar cell pyroptosis
Journal: Apoptosis | Authors: Shuang Lyu | Species: mouse | Application: IF - From stem cells to nanomedicine: A multimodal approach targeting pancreatic fibrosis via MFGE8-dependent ANXA1-SMAD2/3 axis.
Journal: Int J Biol Macromol | Authors: Wangcheng Xie | Species: mouse,human | Application: IF - Disruption of the Circadian Rhythm Induces Acute Pancreatitis via Amino Acid Metabolism-Mediated Macrophage Infiltration.
Journal: Cell Mol Gastroenterol Hepatol | Authors: Haitao Li | Species: mouse | Application: IF - The vagus nerve activated by inflammation co-transmits acute visceral pain via the NTS-PVN pathway.
Journal: Brain Behav Immun | Authors: Yu-Ting Zhao | Species: mouse | Application: IF - Berberine inhibits pancreatic intraepithelial neoplasia by inhibiting glycolysis via the adenosine monophosphate -activated protein kinase pathway.
Journal: Eur J Pharmacol | Authors: Mengmeng Liu | Species: mouse | Application: IF - Gastrodin ameliorates acute pancreatitis by modulating macrophage inflammation cascade via inhibition the p38/NF-κB pathway
Journal: Int Immunopharmacol | Authors: Yalan Jiang | Species: mouse | Application: WB,IHC - ATP citrate lyase ablation hampers exocrine regeneration via TLR4/NF-kappaB signaling after acute pancreatitis in mice
Journal: Int Immunopharmacol | Authors: Yu-Pu Hong | Species: mouse | Application: IF - Micheliolide ameliorates severe acute pancreatitis in mice through potentiating Nrf2-mediated anti-inflammation and anti-oxidation effects
Journal: Int Immunopharmacol | Authors: Chen-Yu Wu | Species: human | Application: IHC - Pyrazole derivative Z10 ameliorates acute pancreatitis by inhibiting the ERK/Ddt pathway
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Wenying Zeng - Deficiency of Mesencephalic Astrocyte-Derived Neurotrophic Factor Aggravates Acute Pancreatitis in Mice.
Journal: Am J Pathol | Authors: Hui Li - c-Fos/ERK promotes the progression from pancreatic intraepithelial neoplasia to pancreatic ductal adenocarcinoma.
Journal: Oncol Rep | Authors: Lei You - Serotonin-RhoA/ROCK axis promotes acinar-to-ductal metaplasia in caerulein-induced chronic pancreatitis.
Journal: Biomed Pharmacother | Authors: Xufeng Tao | Species: mouse | Application: IF - Alterations in histology of the aging salivary gland and correlation with the glandular inflammatory microenvironment
Journal: iScience | Authors: Ning Li | Species: rat,human | Application: IF - Colonic mucin-2 attenuates acute necrotizing pancreatitis in rats by modulating intestinal homeostasis
Journal: FASEB J | Authors: Zehua Huang | Species: rat | Application: IF - Decreased neutrophil counts prolong inflammation in acute pancreatitis and cause inflammation spillover to distant organs
Journal: Pancreatology | Authors: Yohei Fukuda | Species: mouse | Application: IHC - Clinicopathological characteristics of pancreatic acinar cell metaplasia associated with Helicobacter pylori infection.
Journal: BMC Gastroenterol | Authors: Takafumi Fuchino | Species: human | Application: IHC - Vacuolization of mucolipidosis type II mouse exocrine gland cells represents accumulation of autolysosomes.
Journal: Mol Biol Cell | Authors: Boonen Marielle M | Species: mouse | Application: IHC - Immunohistochemistry of Salivary Enzymes and Morphology of Salivary Glands in Eurycea (Plethodontidae).
Journal: J Morphol | Authors: Ethan A. MacVicar | Application: IHC - Deficiency of Mesencephalic Astrocyte-derived Neurotrophic Factor Aggravates Acute Pancreatitis in Mice
Journal: bioRxiv | Authors: Hui Li
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
