TCTN2 Polyclonal antibody 17053-1-AP proteintech
$149.00
In stock
SKU
17053-1-AP
| Catalog Number | 17053-1-AP |
| Synonyms | C12orf38, TCTN2, TECT2, Tectonic 2, tectonic family member 2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human colon cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | human colon cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag10725 Product name: Recombinant human TCTN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 351-697 aa of BC009112 Sequence: VIYEEATDLDKFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVVKFLSYNSGNEEELSGNPGYQLGKPVRALNINRMNNVTTLHLWQSAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLRENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGVETRFSSVNWQYQCGLTCEHKADLLPISASVQFIKIPAQLPHPLTRFQINYTEYDCNRNEVCWPQLLYPWTQYYQGELHSQCVAKGLLLLLFLTLALFLSNPWTRICKAYS Predict reactive species |
| Full Name | tectonic family member 2 |
| Calculated Molecular Weight | 697 aa, 77 kDa |
| GenBank Accession Number | BC009112 |
| Gene Symbol | TCTN2 |
| Gene ID (NCBI) | 79867 |
| RRID | AB_2202406 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96GX1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for TCTN2 antibody 17053-1-AP | Download protocol |
| human | IF J Cell Biol Phosphorylation of CEP83 by TTBK2 is necessary for cilia initiation. Authors - Chien-Hui Lo View Article |
| mouse | IF EMBO J Cell type-specific regulation of ciliary transition zone assembly in vertebrates. Authors - Antonia Wiegering View Article |
| Jay (Verified Customer) (12-02-2019) | Methanol Fixation.Immunostaining result shows that Tctn2 localizes to centriole in ciliated NIH3T3 cell (Tctn2;red, Arl13b;green for primary cilia, DAPI;blue for nucleus).The antibody seems to have noisy background in cytoplasm. Applications: Immunofluorescence, Primary Antibody Dilution: 1:100 Cell Tissue Type: Mouse NIH3T3 TCTN2 Antibody Immunofluorescence, validation (1:100 dilution) in Mouse NIH3T3 (Cat no:17053-1-AP) |
| Citations | 11 |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
TCTN2 (tectonic-2 or TECT2) is a type I membrane protein that belongs to the tectonic family, which consists of TCTN1, TCTN2 and TCTN3. Studies in mice suggest that tectonic may be involved in Hedgehog (Hh) signaling, and essential for ciliogenesis. Tectonic is component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. It exists two spilcing isoforms. The first aberrant transcript introduces 104 base pair from intron 13 and would delete 196 original amino acid, introduce two novel amino acids, and prematurely truncate the 697aa protein at residue number 504. The second transcript lacks exon 14 and would delete 195 original amino acids, introduce four novel amino acids, and prematurely truncate the 697 aa protein at residue number 507. The molecular weight of two isoforms are about 50kDa. We detected the 50kDa and 90kDa protein by immunoprecipitaion, but 50kDa protein may be the splicing isoform or non-specific band. Protocols Product Specific Protocols IHC protocol for TCTN2 antibody 17053-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- A transition zone complex regulates mammalian ciliogenesis and ciliary membrane composition.
Journal: Nat Genet | Authors: Garcia-Gonzalo Francesc R FR | Species: human | Application: WB,IF - Mapping the NPHP-JBTS-MKS protein network reveals ciliopathy disease genes and pathways.
Journal: Cell | Authors: Sang Liyun L | Species: mouse | Application: WB - CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base.
Journal: Nat Cell Biol | Authors: Wang Won-Jing WJ | Species: human | Application: WB,IF - Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis.
Journal: Nat Commun | Authors: Hai-Qing Tu | Species: human - Cell type-specific regulation of ciliary transition zone assembly in vertebrates.
Journal: EMBO J | Authors: Antonia Wiegering | Species: mouse | Application: IF - Phosphorylation of CEP83 by TTBK2 is necessary for cilia initiation.
Journal: J Cell Biol | Authors: Chien-Hui Lo | Species: human | Application: IF - Phosphorylation of CEP83 by TTBK2 is necessary for cilia initiation.
Journal: J Cell Biol | Authors: Chien-Hui Lo | Species: human | Application: IF - Comparison of ciliary targeting of two rhodopsin-like GPCRs: role of C-terminal localization sequences in relation to cilium type.
Journal: J Neurosci | Authors: Abhishek Chadha | Species: human | Application: IF - The multifaceted role of EXOC6A in ciliogenesis.
Journal: Elife | Authors: Te-Lin Lin | Species: human | Application: IF - Two functional forms of the Meckel-Gruber syndrome protein TMEM67 generated by proteolytic cleavage by ADAMTS9 mediate Wnt signaling and ciliogenesis
Journal: bioRxiv | Authors: Manu Ahmed | Application: WB - The Multifaceted Role of EXOC6A in Ciliogenesis.
Journal: bioRxiv | Authors: Te-Lin Lin | Species: human | Application: IF
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
