TFEC Polyclonal antibody 29324-1-AP proteintech
$149.00
In stock
SKU
29324-1-AP
| Catalog Number | 29324-1-AP |
| Synonyms | bHLHe34, hTFEC L, TCFEC, TFE C, TFEC, TFECL, transcription factor EC, Transcription factor EC like |
| Host | Rabbit |
| Reactivity | Human, mouse, rat |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells, mouse testis tissue, rat testis tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Positive WB detected in | HepG2 cells, mouse testis tissue, rat testis tissue |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Tested Reactivity | Human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag30973 Product name: Recombinant human TFEC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 91-197 aa of BC029891 Sequence: LPMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQVFIRM Predict reactive species |
| Full Name | transcription factor EC |
| Calculated Molecular Weight | 347 aa, 39 kDa |
| Observed Molecular Weight | 37-50 kDa |
| GenBank Accession Number | BC029891 |
| Gene Symbol | TFEC |
| Gene ID (NCBI) | 22797 |
| RRID | AB_3086117 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14948 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for TFEC antibody 29324-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:1000-1:4000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The DNA-binding factor TFE3 contains adjacent helix-loop-helix (HLH) and leucine zipper (LZ) domains flanked by an upstream basic region. These protein motifs are frequently observed in other transcription factors and are particularly common to members of the Myc family. TFEC shares a bHLH/LZ structure with TFE3 and a closely related protein microphthalmia-associated transcription factor (MITF), which is critically involved in melanocyte differentiation. The expression of TFEC is mainly in fibroblasts, myoblasts, chondrosarcoma cells and myeloma cells. 50kDa human TFEC isoforms are produced by alternative splicing (PMID: 29303964, PMID: 11467950). Protocols Product Specific Protocols WB protocol for TFEC antibody 29324-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
