CoraLite® Plus 488-conjugated TFF2 Monoclonal antibody CL488-66471 proteintech
$479.00
In stock
SKU
CL488-66471
| Catalog Number | CL488-66471 |
| Synonyms | SML1, 2D7B1, SP, Spasmolysin, Spasmolytic polypeptide |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | FC (Intra) |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive FC (Intra) detected in | HeLa cells |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18765 Product name: Recombinant human TFF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Predict reactive species |
| Full Name | trefoil factor 2 |
| Calculated Molecular Weight | 129 aa, 14 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC032820 |
| Gene Symbol | TFF2 |
| Gene ID (NCBI) | 7032 |
| RRID | AB_2934464 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | Q03403 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| FC protocol for CL Plus 488 TFF2 antibody CL488-66471 | Download protocol |
| Citations | - |
| Dilutions | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 2D7B1 |
| Conjugation | CoraLite® Plus 488 |
The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. Protocols Product Specific Protocols FC protocol for CL Plus 488 TFF2 antibody CL488-66471 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
