TGFBR1 Polyclonal antibody 30117-1-AP proteintech
$149.00
In stock
SKU
30117-1-AP
| Catalog Number | 30117-1-AP |
| Synonyms | TGFβ RI, AAT5, Activin A receptor type II-like protein kinase of 53kD, Activin receptor like kinase 5, Activin receptor-like kinase 5 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, sheep |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, IP, ELISA |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells, MDA-MB-231 cells, NCI-H1299 cells, U-87 MG cells, mouse liver tissue, rat liver tissue |
| Tested Applications — Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse ovary tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | A549 cells, MDA-MB-231 cells, NCI-H1299 cells, U-87 MG cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse ovary tissue |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, sheep |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag31620 Product name: Recombinant human TGFBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-180 aa of NM_004612 Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL Predict reactive species |
| Full Name | transforming growth factor, beta receptor 1 |
| Calculated Molecular Weight | 56KD |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | NM_004612 |
| Gene Symbol | TGFBR1 |
| Gene ID (NCBI) | 7046 |
| RRID | AB_3086235 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36897 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TGFBR1 antibody 30117-1-AP | Download protocol |
| IHC protocol for TGFBR1 antibody 30117-1-AP | Download protocol |
| WB protocol for TGFBR1 antibody 30117-1-AP | Download protocol |
| mouse | IF EMBO J A fibroblast-like endothelial cell state promotes atherosclerosis via C/EBPβ-activated TGF-β signaling. Authors - Linge Fan View Article |
| human | WB,IP Cell Commun Signal Prkci promotes colorectal cancer metastasis by phosphorylating and stabilizing Tgfbr1 to activate TGF-β signaling Authors - Peng Li View Article |
| Citations | 22 |
| Dilutions | WB : 1:500-1:3000 IHC : 1:200-1:800 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
TGFBR1 (TGF-beta receptor type-1) encodes a serine/threonine kinase receptor for transforming growth factor-beta. TGFB1, TGFB2 and TGFB3 signals are transduced from the cell surface to the cytoplasm and regulate lots of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Mutations in both TGFBR2 and TGFBR1 were associated with early onset and aggressive thoracic aortic disease with MFS-like skeletal features, but also hypertelorism, craniosynostosis, developmental delay, cleft palate and bifid uvula, congenital heart disease and aneurysms, and dissections throughout the arterial tree with marked arterial tortuosity (PMID: 15731757, PMID: 27879313). Protocols Product Specific Protocols IF protocol for TGFBR1 antibody 30117-1-AP Download protocol IHC protocol for TGFBR1 antibody 30117-1-AP Download protocol WB protocol for TGFBR1 antibody 30117-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Polycomb repressive complex 1 modulates granulosa cell proliferation in early folliculogenesis to support female reproduction
Journal: Theranostics | Authors: Meng Gao | Species: mouse | Application: IF - FERMT2 drives anoikis resistance and peritoneal metastasis by enhancing extracellular matrix deposition in gastric cancer
Journal: Gastric Cancer | Authors: Chao He | Species: human | Application: WB - Targeting the transmembrane cytokine co-receptor neuropilin-1 in distal tubules improves renal injury and fibrosis
Journal: Nat Commun | Authors: Yinzheng Li | Species: mouse | Application: IF - Isoliensinine suppressed gastric cancer cell proliferation and migration by targeting TGFBR1 to regulate TGF-β-smad signaling pathways
Journal: Front Pharmacol | Authors: Jinda Hu | Species: human | Application: WB - A fibroblast-like endothelial cell state promotes atherosclerosis via C/EBPβ-activated TGF-β signaling.
Journal: EMBO J | Authors: Linge Fan | Species: mouse | Application: IF - Prkci promotes colorectal cancer metastasis by phosphorylating and stabilizing Tgfbr1 to activate TGF-β signaling
Journal: Cell Commun Signal | Authors: Peng Li | Species: human | Application: WB,IP - Prkci promotes colorectal cancer metastasis by phosphorylating and stabilizing Tgfbr1 to activate TGF-β signaling
Journal: Cell Commun Signal | Authors: Peng Li | Species: human | Application: WB,IP - A fibroblast-like endothelial cell state promotes atherosclerosis via C/EBPβ-activated TGF-β signaling.
Journal: EMBO J | Authors: Linge Fan | Species: mouse | Application: IF - Colla Corii Asini regulate collagen regeneration in UV exposure-induced skin photoaging in mice
Journal: Chin Med | Authors: Yuman Ma | Application: WB - FERMT2 drives anoikis resistance and peritoneal metastasis by enhancing extracellular matrix deposition in gastric cancer
Journal: Gastric Cancer | Authors: Chao He | Species: human | Application: WB - IL-27 alleviates high-fat diet-induced obesity and metabolic disorders by inhibiting adipogenesis via activating HDAC6
Journal: Commun Biol | Authors: Yinsheng Zhong | Species: mouse | Application: WB - Exosomal microRNAs of tuberculous pleural effusion orchestrating TGF-β signaling mediate pleural fibrosis.
Journal: Respir Res | Authors: Li-Juan Jiang | Species: human | Application: WB - Exosomal microRNAs of tuberculous pleural effusion orchestrating TGF-β signaling mediate pleural fibrosis.
Journal: Respir Res | Authors: Li-Juan Jiang | Species: human | Application: WB - Isoliensinine suppressed gastric cancer cell proliferation and migration by targeting TGFBR1 to regulate TGF-β-smad signaling pathways
Journal: Front Pharmacol | Authors: Jinda Hu | Species: human | Application: WB - BMP15 regulates proliferation of sheep granulosa cells with different genotypes via the TGF-β/SMAD signaling pathway.
Journal: J Ovarian Res | Authors: Qing Liu | Species: sheep | Application: WB - IL27RA promotes the proliferation and metastasis of hepatocellular carcinoma cells by regulating TGFβR1.
Journal: Sci Rep | Authors: YiJie Zhang | Species: human | Application: WB - A Brain-Targeting Curcumin Analog Inhibits Glioblastoma Progression Through THBS1/TGF-β1/PI3K-AKT Axis Modulation: Evidence From Experimental and Bioinformatic Analyses.
Journal: J Cell Mol Med | Authors: Zijian Han | Species: human | Application: WB - Lnc PVT1 facilitates TGF-β1-induced human cardiac fibroblast activation in vitro and ISO-induced myocardial fibrosis in vivo through regulating MYC
Journal: Mol Cell Biochem | Authors: Juan Wang | Species: human | Application: WB - A Brain-Targeting Curcumin Analog Inhibits Glioblastoma Progression Through THBS1/TGF-β1/PI3K-AKT Axis Modulation: Evidence From Experimental and Bioinformatic Analyses.
Journal: J Cell Mol Med | Authors: Zijian Han | Species: human | Application: WB - ANRIL upregulates TGFBR1 to promote idiopathic pulmonary fibrosis in TGF-β1-treated lung fibroblasts via sequestering let-7d-5p
Journal: Epigenetics | Authors: Weidong Wu | Species: human | Application: WB - Lrg1 silencing attenuates ischemia-reperfusion renal injury by regulating autophagy and apoptosis through the TGFβ1- Smad1/5 signaling pathway
Journal: Arch Biochem Biophys | Authors: Jianhui Chen | Species: mouse,human | Application: WB - Bone transport accelerates diabetic foot ulcer healing via TGF-β1-mediated angiogenic and osteo-immune coupling.
Journal: J Mol Histol | Authors: Yan Chen | Species: rat | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
