TGIF2 Polyclonal antibody 11522-1-AP proteintech
$149.00
In stock
SKU
11522-1-AP
| Catalog Number | 11522-1-AP |
| Synonyms | TGF-beta-induced transcription factor 2, TGFB induced factor homeobox 2, TGFB induced factor 2, Homeobox protein TGIF2, 5'-TG-3'-interacting factor 2 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A431 cells, Daudi cells, HL-60 cells, Jurkat cells |
| Tested Applications — Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | Caco-2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | A431 cells, Daudi cells, HL-60 cells, Jurkat cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Caco-2 cells |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2085 Product name: Recombinant human TGIF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC012816 Sequence: MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ Predict reactive species |
| Full Name | TGFB-induced factor homeobox 2 |
| Calculated Molecular Weight | 237 aa, 26 kDa |
| Observed Molecular Weight | 28 kDa and 30 kDa |
| GenBank Accession Number | BC012816 |
| Gene Symbol | TGIF2 |
| Gene ID (NCBI) | 60436 |
| RRID | AB_2202731 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9GZN2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TGIF2 antibody 11522-1-AP | Download protocol |
| IHC protocol for TGIF2 antibody 11522-1-AP | Download protocol |
| WB protocol for TGIF2 antibody 11522-1-AP | Download protocol |
| mouse | WB Adipocyte WDR4-mediate tRNA m7G modification to promote mitophagy and browning of white adipose tissue for ameliorating obesity in male mice. Authors - Beisi Lin View Article |
| human | WB Nat Chem Biol Charged molecular glue discovery enabled by targeted degron display. Authors - Zhe Zhuang View Article |
| Citations | 9 |
| Dilutions | WB : 1:1000-1:8000 IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Transforming growth factor-beta-induced factor 2(TGIF2), is a member of a subfamily of transcription factor with a TALE(3-amino acid loop extension), an atypical homeodomain. It also contains a proline-rich region, which is a putative SH3 domain-binding site and suggested involve in transcriptional regulation. It is highly expressed in the heart, kidney, and testis, but low in the brain and prostate. Through binding directly to the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins, TGIF2 acts as a transcriptional repressor. The calculated molecular weight of TGIF2 is 26 kDa, but the phosphorylated TGIF2 is about 30-35 kDa protein. This antibody detected two forms of bands of about 28 and 30 kDa, and the upper band appears to result from increased phosphorylation (PMID: 11427533). Protocols Product Specific Protocols IF protocol for TGIF2 antibody 11522-1-AP Download protocol IHC protocol for TGIF2 antibody 11522-1-AP Download protocol WB protocol for TGIF2 antibody 11522-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Tgif1 Counterbalances the Activity of Core Pluripotency Factors in Mouse Embryonic Stem Cells.
Journal: Cell Rep | Authors: Bum-Kyu Lee | Species: mouse | Application: WB - The human RNA-binding protein RBFA promotes the maturation of the mitochondrial ribosome.
Journal: Biochem J | Authors: Agata Rozanska | Species: human | Application: WB - Molecular mechanisms in vascular injury induced by hypertension: Expression and role of microRNA-34a.
Journal: Exp Ther Med | Authors: Siguan Liu | Species: human | Application: WB - Downregulation of TGIF2 is possibly correlated with neuronal apoptosis and autism-like symptoms in mice.
Journal: Brain Behav | Authors: Jing Lei | Species: mouse | Application: WB - Charged molecular glue discovery enabled by targeted degron display.
Journal: Nat Chem Biol | Authors: Zhe Zhuang | Species: human | Application: WB - WDR4-mediate tRNA m7G modification to promote mitophagy and browning of white adipose tissue for ameliorating obesity in male mice.
Journal: Adipocyte | Authors: Beisi Lin | Species: mouse | Application: WB - WDR4-mediate tRNA m7G modification to promote mitophagy and browning of white adipose tissue for ameliorating obesity in male mice.
Journal: Adipocyte | Authors: Beisi Lin | Species: mouse | Application: WB - Downregulation of TGIF2 is possibly correlated with neuronal apoptosis and autism-like symptoms in mice.
Journal: Brain Behav | Authors: Jing Lei | Species: mouse | Application: WB - Molecular mechanisms in vascular injury induced by hypertension: Expression and role of microRNA-34a.
Journal: Exp Ther Med | Authors: Siguan Liu | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
