TIM10 Polyclonal antibody 11124-2-AP proteintech
$149.00
In stock
SKU
11124-2-AP
| Catalog Number | 11124-2-AP |
| Synonyms | TIMM10, TIM10A, TIMM10A |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | MCF-7 cells, MDA-MB-231 cells |
| Tested Applications — Positive IHC detected in | human colon cancer tissue, mouse cerebellum tissue, rat cerebellum tissue, rat heart tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | MCF-7 cells, MDA-MB-231 cells |
| Positive IHC detected in | human colon cancer tissue, mouse cerebellum tissue, rat cerebellum tissue, rat heart tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1615 Product name: Recombinant human TIMM10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC032133 Sequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 10 homolog (yeast) |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC032133 |
| Gene Symbol | TIMM10 |
| Gene ID (NCBI) | 26519 |
| RRID | AB_2201981 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62072 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TIM10 antibody 11124-2-AP | Download protocol |
| IHC protocol for TIM10 antibody 11124-2-AP | Download protocol |
| WB protocol for TIM10 antibody 11124-2-AP | Download protocol |
| human | WB PLoS One Megakaryocytic Differentiation of K562 Cells Induced by PMA Reduced the Activity of Respiratory Chain Complex IV. Authors - Rui Huang View Article |
| rat | WB Redox Biol Hypoxic acclimation improves cardiac redox homeostasis and protects heart against ischemia-reperfusion injury through upregulation of O-GlcNAcylation. Authors - Wei Ou View Article |
| Wenhui (Verified Customer) (01-02-2025) | This antibody has been working great with WB and gives well define band. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Cardiac tissue and cardiomyocytes |
| Citations | 3 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:250-1:1000 IF-P : 1:200-1:800 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal.
Journal: Cell Stem Cell | Authors: Rashim Pal Singh | Species: human | Application: WB - Hypoxic acclimation improves cardiac redox homeostasis and protects heart against ischemia-reperfusion injury through upregulation of O-GlcNAcylation.
Journal: Redox Biol | Authors: Wei Ou | Species: rat | Application: WB - Megakaryocytic Differentiation of K562 Cells Induced by PMA Reduced the Activity of Respiratory Chain Complex IV.
Journal: PLoS One | Authors: Rui Huang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
