TLR7 Polyclonal antibody 17232-1-AP proteintech
$149.00
In stock
SKU
17232-1-AP
| Catalog Number | 17232-1-AP |
| Synonyms | CD287, TLR7/CD587, toll like receptor 7, Toll-like receptor 7, UNQ248/PRO285 |
| Host | Rabbit |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Daudi cells, Jurkat cells, mouse lung tissue, J774A.1 cells, MG-63 cells |
| Tested Applications — Positive IHC detected in | human lung tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | RAW 264.7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | Daudi cells, Jurkat cells, mouse lung tissue, J774A.1 cells, MG-63 cells |
| Positive IHC detected in | human lung tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | RAW 264.7 cells |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag11073 Product name: Recombinant human TLR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-348 aa of BC033651 Sequence: LLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLS Predict reactive species |
| Full Name | toll-like receptor 7 |
| Calculated Molecular Weight | 1049 aa, 121 kDa |
| Observed Molecular Weight | 121 kDa, 100 kDa |
| GenBank Accession Number | BC033651 |
| Gene Symbol | TLR7 |
| Gene ID (NCBI) | 51284 |
| RRID | AB_2203464 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYK1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TLR7 antibody 17232-1-AP | Download protocol |
| IHC protocol for TLR7 antibody 17232-1-AP | Download protocol |
| WB protocol for TLR7 antibody 17232-1-AP | Download protocol |
| human | WB Stem Cell Res Ther Exosomal SNHG16 secreted by CSCs promotes glioma development via TLR7. Authors - Ruijie Zhang KD Validated View Article |
| mouse,human | WB,IF Sci Transl Med The m6A demethylase FTO links TLR7 to mitochondrial oxidation driving age-associated B cell formation in systemic lupus erythematosus Authors - Qin Zeng View Article |
| rat | WB Acta Physiol (Oxf) Keratin 1 attenuates hypoxic pulmonary artery hypertension by suppressing pulmonary artery media smooth muscle expansion. Authors - Li Zhang View Article |
| mouse | WB Front Immunol Precision N-Glycoproteomic Profiling of Murine Peritoneal Macrophages After Different Stimulations. Authors - Lujie Yang View Article |
| Citations | 21 |
| Dilutions | WB : 1:500-1:3000 IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Among the TLR family, TLR7 (toll-like receptor 7) is an endosomal innate immune sensor that can detect single-stranded ribonucleic acid. Constitutive expression of TLR7 is pre-dominant in dendritic cells and B cells compared to other immune cells. Low levels of TLR7 expression have been observed in non-immune cells, such as hepatocytes, epithelial cells, and keratinocytes (PMID: 37596656). Protocols Product Specific Protocols IF protocol for TLR7 antibody 17232-1-AP Download protocol IHC protocol for TLR7 antibody 17232-1-AP Download protocol WB protocol for TLR7 antibody 17232-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- TLR7 promotes smoke-induced experimental lung damage through the activity of mast cell tryptase
Journal: Nat Commun | Authors: Gang Liu | Species: human | Application: IHC - The m6A demethylase FTO links TLR7 to mitochondrial oxidation driving age-associated B cell formation in systemic lupus erythematosus
Journal: Sci Transl Med | Authors: Qin Zeng | Species: mouse,human | Application: WB,IF - Keratin 1 attenuates hypoxic pulmonary artery hypertension by suppressing pulmonary artery media smooth muscle expansion.
Journal: Acta Physiol (Oxf) | Authors: Li Zhang | Species: rat | Application: WB - Exosomal SNHG16 secreted by CSCs promotes glioma development via TLR7.
Journal: Stem Cell Res Ther | Authors: Ruijie Zhang KD Validated | Species: human | Application: WB - Let-7b-TLR7 Signaling Axis Contributes to the Anesthesia/Surgery-Induced Cognitive Impairment
Journal: Mol Neurobiol | Authors: Liyun Deng | Species: mouse | Application: WB,IF - Precision N-Glycoproteomic Profiling of Murine Peritoneal Macrophages After Different Stimulations.
Journal: Front Immunol | Authors: Lujie Yang | Species: mouse | Application: WB - Precision N-Glycoproteomic Profiling of Murine Peritoneal Macrophages After Different Stimulations.
Journal: Front Immunol | Authors: Lujie Yang | Species: mouse | Application: WB - Keratin 1 attenuates hypoxic pulmonary artery hypertension by suppressing pulmonary artery media smooth muscle expansion.
Journal: Acta Physiol (Oxf) | Authors: Li Zhang | Species: rat | Application: WB - Apigenin attenuated sepsis induced acute lung injury via polarizing macrophage towards M2 by blocking miR-146a →TLR7 interaction
Journal: Int Immunopharmacol | Authors: Jiafeng Geng | Species: mouse | Application: WB - Let-7b-TLR7 Signaling Axis Contributes to the Anesthesia/Surgery-Induced Cognitive Impairment
Journal: Mol Neurobiol | Authors: Liyun Deng | Species: mouse | Application: WB,IF - Huang Lian Jie Du Decoction enhances the anti-tumor efficacy of immune checkpoint inhibitors by activating TLR7/8 signalling in melanoma
Journal: BMC Complement Med Ther | Authors: Suqing Liu | Species: mouse | Application: IHC - Ginsenoside Rc Improves Chilled Storage Quality of Lower-Layer X-Bearing Dairy Goat Spermatozoa Through Enhanced Mitochondrial Function and Antioxidant Capacity.
Journal: Biology (Basel) | Authors: Songmao Guo - Bushen Huoxue Recipe enhances the immune microenvironment at the maternal-fetal interface via the Hippo signaling pathway in mice with recurrent spontaneous abortion.
Journal: J Tradit Complement Med | Authors: Lei Xia | Species: mouse | Application: WB,IF - Dissecting the role of toll-like receptor 7 in pancreatic cancer
Journal: Cancer Med | Authors: Maren Stark | Species: human | Application: WB,IHC - GPR108 Negatively Regulates TLR7 Signaling in Imiquimod-Induced Psoriasiform Dermatitis.
Journal: Immun Inflamm Dis | Authors: Wenwen Wang | Species: mouse | Application: WB,IHC - Down-regulation of miR-144 elicits proinflammatory cytokine production by targeting toll-like receptor 2 in nonalcoholic steatohepatitis of high-fat-diet-induced metabolic syndrome E3 rats.
Journal: Mol Cell Endocrinol | Authors: Dongmin Li | Species: rat | Application: WB - Pan-organ damage analysis in the R848-induced systemic lupus erythematosus mouse model.
Journal: Cell Immunol | Authors: Xiaoliu Li | Species: mouse | Application: WB - Elevated expression of Toll-like receptor 7 and its correlation with clinical features in patients with primary Sjögren's syndrome
Journal: Adv Rheumatol | Authors: Huimin Yang | Species: human | Application: IHC - Sodium ferulate protects against influenza virus infection by activation of the TLR7/9-MyD88-IRF7 signaling pathway and inhibition of the NF-κB signaling pathway.
Journal: Biochem Biophys Res Commun | Authors: Yanhui Zhu | Species: mouse | Application: WB - Effect of HMGB1 on monocyte immune function in respiratory syncytial virus bronchiolitis.
Journal: Exp Ther Med | Authors: Mingyang Niu | Species: human | Application: WB - Lignans from Mosla scabra Ameliorated Influenza A Virus-Induced Pneumonia via Inhibiting Macrophage Activation
Journal: Evid Based Complement Alternat Med | Authors: Wei Cai | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
