TMBIM6 Polyclonal antibody 26782-1-AP proteintech
$149.00
In stock
SKU
26782-1-AP
| Catalog Number | 26782-1-AP |
| Synonyms | Bax inhibitor 1, BI 1, BI1, BI-1, TEGT |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse liver tissue |
| Tested Applications — Positive IP detected in | mouse testis tissue |
| Tested Applications — Positive IHC detected in | human testis tissue, mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Positive WB detected in | mouse liver tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | human testis tissue, mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag24780 Product name: Recombinant human TMBIM6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-86 aa of BC000916 Sequence: MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLG Predict reactive species |
| Full Name | transmembrane BAX inhibitor motif containing 6 |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC000916 |
| Gene Symbol | TMBIM6 |
| Gene ID (NCBI) | 7009 |
| RRID | AB_2880633 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55061 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for TMBIM6 antibody 26782-1-AP | Download protocol |
| IP protocol for TMBIM6 antibody 26782-1-AP | Download protocol |
| WB protocol for TMBIM6 antibody 26782-1-AP | Download protocol |
| human | WB J Cell Physiol Involvement of miR-27a-3p in diabetic nephropathy via affecting renal fibrosis, mitochondrial dysfunction, and endoplasmic reticulum stress. Authors - Lina Wu View Article |
| Citations | 10 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- FBXO11 enhances colorectal cancer progression through TMBIM6 stabilization: Echinacoside as a natural inhibitor.
Journal: Phytomedicine | Authors: Chenghai He - Transcription factor TCF3 promotes bladder cancer development via TMBIM6-Ca2+-dependent ferroptosis
Journal: Cell Death Discov | Authors: Wei-Feng Yang - Methyltransferase-like 3 aggravates endoplasmic reticulum stress in preeclampsia by targeting TMBIM6 in YTHDF2-dependent manner
Journal: Mol Med | Authors: Yangyang Chen | Species: human | Application: WB,IHC - 13-oxyingenol dodecanoate derivatives induce mitophagy and ferroptosis through targeting TMBIM6 as potential anti-NSCLC agents
Journal: Eur J Med Chem | Authors: Yaxu Wang | Species: human | Application: WB,IF - The role of hsa_circ_0000520 in breast cancer progression: insights into the miR-542-3p/TMBIM6 regulatory axis.
Journal: Cancer Gene Ther | Authors: Feng Wang | Species: human | Application: WB - Involvement of miR-27a-3p in diabetic nephropathy via affecting renal fibrosis, mitochondrial dysfunction, and endoplasmic reticulum stress.
Journal: J Cell Physiol | Authors: Lina Wu | Species: human | Application: WB - Methyltransferase-like 14 (METTL14)-mediated N6-methyladenosine (m6A) Modification of Forkhead Box Protein 1 (FOXP1) Regulates Trophoblast Inflammation and Function via Transmembrane BAX Inhibitor Motif-Containing 6 (TMBIM6).
Journal: J Biochem Mol Toxicol | Authors: Yanhua Liu | Species: human | Application: WB - LncRNA SNHG1 acts as a ceRNA for miR-216a-3p to regulate TMBIM6 expression in esophageal squamous cell carcinoma
Journal: J Cancer | Authors: Ni Kong | Species: human | Application: WB - TMBIM6 promotes diabetic tubular epithelial cell survival and albumin endocytosis by inhibiting the endoplasmic reticulum stress sensor, IRE1α.
Journal: Mol Biol Rep | Authors: Huidi Xie | Species: mouse,human | Application: WB,IHC,IF - The ADAM17 sheddase complex regulator iTAP/Frmd8 modulates inflammation and tumor growth
Journal: Life Sci Alliance | Authors: Marina Badenes | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
