TMEM111 Monoclonal antibody, PBS Only (Capture) 67205-4-PBS proteintech
$699.00
In stock
SKU
67205-4-PBS
| Catalog Number | 67205-4-PBS |
| Synonyms | EMC3, POB |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18365 Product name: Recombinant human TMEM111 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 139-261 aa of BC022807 Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF Predict reactive species |
| Full Name | transmembrane protein 111 |
| Calculated Molecular Weight | 261 aa, 30 kDa |
| GenBank Accession Number | BC022807 |
| Gene Symbol | TMEM111 |
| Gene ID (NCBI) | 55831 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9P0I2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 3B9E1 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
