TMEM176A Polyclonal antibody 20378-1-AP proteintech
$149.00
In stock
SKU
20378-1-AP
| Catalog Number | 20378-1-AP |
| Synonyms | GS188, HCA112, Hepatocellular carcinoma-associated antigen 112, Transmembrane protein 176A |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | fetal human brain tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | fetal human brain tissue |
| Positive IHC detected in | mouse brain tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14194 Product name: Recombinant human TMEM176A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-203 aa of BC008303 Sequence: LAAFSTAIAALKLWNEDFRYGYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQAMLLGVWILLL Predict reactive species |
| Full Name | transmembrane protein 176A |
| Calculated Molecular Weight | 235 aa, 26 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC008303 |
| Gene Symbol | TMEM176A |
| Gene ID (NCBI) | 55365 |
| RRID | AB_10697661 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96HP8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TMEM176A antibody 20378-1-AP | Download protocol |
| IHC protocol for TMEM176A antibody 20378-1-AP | Download protocol |
| WB protocol for TMEM176A antibody 20378-1-AP | Download protocol |
| human | IHC,IF Int Immunopharmacol TMEM176A drives anti-apoptotic signaling through TGM2-mediated ERK activation in gastric cancer. Authors - Yating Zhang View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- TMEM176A drives anti-apoptotic signaling through TGM2-mediated ERK activation in gastric cancer.
Journal: Int Immunopharmacol | Authors: Yating Zhang | Species: human | Application: IHC,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
