TMEM189 Recombinant monoclonal antibody, PBS Only (Detector) 83388-1-PBS proteintech
$699.00
In stock
SKU
83388-1-PBS
| Catalog Number | 83388-1-PBS |
| Synonyms | EC:1.14.19.77, KUA, PDES, PEDS1, Plasmanylethanolamine desaturase 1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag34323 Product name: Recombinant human TMEM189 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 182-270 aa of BC142966 Sequence: TNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK Predict reactive species |
| Full Name | transmembrane protein 189 |
| GenBank Accession Number | BC142966 |
| Gene Symbol | TMEM189 |
| Gene ID (NCBI) | 387521 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | A5PLL7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240376B5 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
