TMEM35 Recombinant monoclonal antibody 86724-1-RR proteintech
$149.00
In stock
SKU
86724-1-RR
| Catalog Number | 86724-1-RR |
| Synonyms | NACHO, Novel acetylcholine receptor chaperone, TMEM35A, transmembrane protein 35 |
| Host | Rabbit |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, rat brain tissue, mouse spinal cord tissue, rat spinal cord tissue, mouse cerebellum tissue, rat cerebellum tissue |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Positive WB detected in | mouse brain tissue, rat brain tissue, mouse spinal cord tissue, rat spinal cord tissue, mouse cerebellum tissue, rat cerebellum tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat, pig |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag20589 Product name: Recombinant human TMEM35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-167 aa of BC078658 Sequence: LTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS Predict reactive species |
| Full Name | transmembrane protein 35 |
| Calculated Molecular Weight | 167 aa, 18 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC078658 |
| Gene Symbol | TMEM35 |
| Gene ID (NCBI) | 59353 |
| RRID | AB_3745080 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q53FP2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TMEM35 antibody 86724-1-RR | Download protocol |
| IHC protocol for TMEM35 antibody 86724-1-RR | Download protocol |
| IP protocol for TMEM35 antibody 86724-1-RR | Download protocol |
| WB protocol for TMEM35 antibody 86724-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF-P : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251680G5 |
| Conjugation | Unconjugated |
TMEM35 is a 167-amino acid peptide with a putative NH2 terminal signal peptide, three hydrophobic transmembrane domains, and a nerve growth factor binding domain.TMEM35is 18kDa and has been shown to localize to membrane-bound structures within cells. Protocols Product Specific Protocols IF protocol for TMEM35 antibody 86724-1-RR Download protocol IHC protocol for TMEM35 antibody 86724-1-RR Download protocol IP protocol for TMEM35 antibody 86724-1-RR Download protocol WB protocol for TMEM35 antibody 86724-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
