TMEM41A Polyclonal antibody 20768-1-AP proteintech
$149.00
In stock
SKU
20768-1-AP
| Catalog Number | 20768-1-AP |
| Synonyms | 2900010K02Rik, TMEM41A, transmembrane protein 41A |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse liver tissue, mouse small intestine tissue, rat liver tissue, HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | mouse liver tissue, mouse small intestine tissue, rat liver tissue, HepG2 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14753 Product name: Recombinant human TMEM41A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC008043 Sequence: MRPLLGLLLVFAGCTFALYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCGAYLYK Predict reactive species |
| Full Name | transmembrane protein 41A |
| Calculated Molecular Weight | 264 aa, 30 kDa |
| Observed Molecular Weight | 26-28 kDa |
| GenBank Accession Number | BC008043 |
| Gene Symbol | TMEM41A |
| Gene ID (NCBI) | 90407 |
| RRID | AB_10693679 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96HV5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for TMEM41A antibody 20768-1-AP | Download protocol |
| human | WB J Cell Biol Genome-wide CRISPR screen identifies TMEM41B as a gene required for autophagosome formation. Authors - Keigo Morita KD Validated View Article |
| mouse | WB bioRxiv TMEM41B is a pan-flavivirus host factor. Authors - H-Heinrich Hoffmann KO Validated View Article |
| Citations | 3 |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- TMEM41B Is a Pan-flavivirus Host Factor.
Journal: Cell | Authors: H-Heinrich Hoffmann KO Validated | Species: human | Application: WB - Genome-wide CRISPR screen identifies TMEM41B as a gene required for autophagosome formation.
Journal: J Cell Biol | Authors: Keigo Morita KD Validated | Species: human | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
