TMIGD1 Recombinant monoclonal antibody, PBS Only (Capture/Detector) 84130-4-PBS proteintech
$699.00
In stock
SKU
84130-4-PBS
| Catalog Number | 84130-4-PBS |
| Synonyms | TMIGD, Transmembrane and immunoglobulin domain-containing protein 1, UNQ9372/PRO34164 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25691 Product name: Recombinant human TMIGD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-207 aa of BC137201 Sequence: VEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLD Predict reactive species |
| Full Name | transmembrane and immunoglobulin domain containing 1 |
| Calculated Molecular Weight | 262 aa, 29 kDa |
| GenBank Accession Number | BC137201 |
| Gene Symbol | TMIGD1 |
| Gene ID (NCBI) | 388364 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6UXZ0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241399G9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
