TNC/Tenascin-C Polyclonal antibody 27789-1-AP proteintech
$149.00
In stock
SKU
27789-1-AP
| Catalog Number | 27789-1-AP |
| Synonyms | Tenascin, TNC, Glioma-associated-extracellular matrix antigen, GMEM, GP 150 225 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | U-87 MG cells |
| Tested Applications — Positive IP detected in | U-87 MG cells |
| Tested Applications — Positive IHC detected in | human liver cancer tissue, human breast cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Positive WB detected in | U-87 MG cells |
| Positive IP detected in | U-87 MG cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag27122 Product name: Recombinant human TNC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-200 aa of BC151843 Sequence: GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRC Predict reactive species |
| Full Name | tenascin C |
| Calculated Molecular Weight | 2201 aa, 241 kDa |
| Observed Molecular Weight | 210-350 kDa |
| GenBank Accession Number | BC151843 |
| Gene Symbol | Tenascin C |
| Gene ID (NCBI) | 3371 |
| RRID | AB_2918131 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24821 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for TNC/Tenascin-C antibody 27789-1-AP | Download protocol |
| IP protocol for TNC/Tenascin-C antibody 27789-1-AP | Download protocol |
| WB protocol for TNC/Tenascin-C antibody 27789-1-AP | Download protocol |
| human | WB Chin Med Aidi injection inhibits the migration and invasion of gefitinib-resistant lung adenocarcinoma cells by regulating the PLAT/FAK/AKT pathway Authors - Jingyuan Zhang View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation. In normal esophageal tissue, only one isoform of Tenascin-C (210 kDa) was identified, whereas at least three isoforms (210 kDa, 250 kDa, and 350 kDa) were found in esophageal cancer tissue(PMID: 26731558). It is also reported that tenascin-C exists as two isoforms of approximately 160 kDa and 280 kDa in both healthy and RA patient samples(PMID: 38077374). Protocols Product Specific Protocols IHC protocol for TNC/Tenascin-C antibody 27789-1-AP Download protocol IP protocol for TNC/Tenascin-C antibody 27789-1-AP Download protocol WB protocol for TNC/Tenascin-C antibody 27789-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Aidi injection inhibits the migration and invasion of gefitinib-resistant lung adenocarcinoma cells by regulating the PLAT/FAK/AKT pathway
Journal: Chin Med | Authors: Jingyuan Zhang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
