TNFRSF9/CD137 Recombinant monoclonal antibody, PBS Only 83893-2-PBS proteintech
$699.00
In stock
SKU
83893-2-PBS
| Catalog Number | 83893-2-PBS |
| Synonyms | TNFRSF9, 4 1BB, 4 1BB ligand receptor, 4-1BB ligand receptor, CD137 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0016 Product name: Recombinant Human TNFRSF9/CD137 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 24-186 aa of BC006196 Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ Predict reactive species |
| Full Name | tumor necrosis factor receptor superfamily, member 9 |
| Calculated Molecular Weight | 28 kDa |
| GenBank Accession Number | BC006196 |
| Gene Symbol | TNFRSF9/CD137 |
| Gene ID (NCBI) | 3604 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q07011 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241006E8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
