TOB1 Polyclonal antibody 14915-1-AP proteintech
$149.00
In stock
SKU
14915-1-AP
| Catalog Number | 14915-1-AP |
| Synonyms | APRO6, PIG49, Protein Tob1, TOB, Transducer of erbB 2 1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag6714 Product name: Recombinant human TOB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC031406 Sequence: MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN Predict reactive species |
| Full Name | transducer of ERBB2, 1 |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 38-45 kDa |
| GenBank Accession Number | BC031406 |
| Gene Symbol | TOB1 |
| Gene ID (NCBI) | 10140 |
| RRID | AB_10896496 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50616 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for TOB1 antibody 14915-1-AP | Download protocol |
| IP protocol for TOB1 antibody 14915-1-AP | Download protocol |
| WB protocol for TOB1 antibody 14915-1-AP | Download protocol |
| human | WB,IHC Cancer Med TOB1 suppresses proliferation in K-Ras wild-type pancreatic cancer. Authors - Yuru Bai View Article |
| mouse | WB J Cell Sci Loss of Tob1 promotes muscle regeneration through muscle stem cell expansion Authors - Yasuo Kitajima KO Validated View Article |
| Citations | 10 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
TOB1, also known as APRO6 or TROB1, is a member of the transducer of erbB-2/B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The TOB1 protein has a large additional C-terminal region, which contains PAM2 motifs that mediate interactions with poly(A)-binding proteins. It is mainly located in the cell nucleus and will transfer between the cell nucleus and the cytoplasm. The more phosphorylation, the more obvious the cytoplasmic localization.The predicted MW of this protein is 38 kDa. Catalog#14915-1-AP recognises 38 and 45 kDa band, and the additional 45 kDa band may be due to phosphorylation. Protocols Product Specific Protocols IHC protocol for TOB1 antibody 14915-1-AP Download protocol IP protocol for TOB1 antibody 14915-1-AP Download protocol WB protocol for TOB1 antibody 14915-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Screening key microRNAs for castration-resistant prostate cancer based on miRNA/mRNA functional synergistic network.
Journal: Oncotarget | Authors: Jin Zhu | Species: human | Application: WB - NEDD4 triggers FOXA1 ubiquitination and promotes colon cancer progression under microRNA-340-5p suppression and ATF1 upregulation.
Journal: RNA Biol | Authors: Meng Yue | Species: mouse | Application: IHC - Preferential translation of p53 target genes.
Journal: RNA Biol | Authors: Miharu Hisaoka | Species: human | Application: WB - Phosphorylation of TOB1 at T172 and S320 is critical for gastric cancer proliferation and progression.
Journal: Am J Transl Res | Authors: Dong Wang | Species: human | Application: WB - TOB1 suppresses proliferation in K-Ras wild-type pancreatic cancer.
Journal: Cancer Med | Authors: Yuru Bai | Species: human | Application: WB,IHC - Loss of Tob1 promotes muscle regeneration through muscle stem cell expansion
Journal: J Cell Sci | Authors: Yasuo Kitajima KO Validated | Species: mouse | Application: WB - NEDD4 triggers FOXA1 ubiquitination and promotes colon cancer progression under microRNA-340-5p suppression and ATF1 upregulation.
Journal: RNA Biol | Authors: Meng Yue | Species: mouse | Application: IHC - Loss of Tob1 promotes muscle regeneration through muscle stem cell expansion
Journal: J Cell Sci | Authors: Yasuo Kitajima | Species: mouse | Application: WB - TOB1 suppresses proliferation in K-Ras wild-type pancreatic cancer.
Journal: Cancer Med | Authors: Yuru Bai | Species: human | Application: WB,IHC - Phosphorylation of TOB1 at T172 and S320 is critical for gastric cancer proliferation and progression.
Journal: Am J Transl Res | Authors: Dong Wang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
