ANKS1B Polyclonal antibody 24783-1-AP proteintech
$149.00
In stock
SKU
24783-1-AP
| Catalog Number | 24783-1-AP |
| Synonyms | AIDA, AIDA 1, Amyloid-beta protein intracellular domain-associated protein 1, ANKS2, Ankyrin repeat and sterile alpha motif domain-containing protein 1B |
| Host | Rabbit |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells, HeLa cells, mouse testis tissue |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | A549 cells, HeLa cells, mouse testis tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag20454 Product name: Recombinant human ANKS1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-510 aa of BC026313 Sequence: GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF Predict reactive species |
| Full Name | ankyrin repeat and sterile alpha motif domain containing 1B |
| Calculated Molecular Weight | 1248 aa, 138 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC026313 |
| Gene Symbol | ANKS1B |
| Gene ID (NCBI) | 56899 |
| RRID | AB_2879720 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z6G8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for ANKS1B antibody 24783-1-AP | Download protocol |
| IHC protocol for ANKS1B antibody 24783-1-AP | Download protocol |
| IP protocol for ANKS1B antibody 24783-1-AP | Download protocol |
| WB protocol for ANKS1B antibody 24783-1-AP | Download protocol |
| human | WB EBioMedicine Juvenile CLN3 disease is a lysosomal cholesterol storage disorder: similarities with Niemann-Pick type C disease Authors - Jacinda Chen View Article |
| rat | WB,IF Adv Sci (Weinh) ANKS1B in the Nucleus Accumbens Controls Escalated Cocaine Self-Administration via Regulating CBP-FoxO3 Complex. Authors - Liping Yang View Article |
| Citations | 3 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
ANKS1B also named as AIDA or cajalin 2 is a amino acid protein, which contains 7 ANK repeats, 1 PID domain and 2 SAM domains. ANKS1B localizes in cytoplasm and is highly expressed in brain and testis. ANKS1B exists as many alternatively spliced isoforms. It interacts with AbPP to play a role in brain development. AIDA-1 also interacts with coilin in Cajal bodies to regulate pre-mRNA splicing. Protocols Product Specific Protocols IF protocol for ANKS1B antibody 24783-1-AP Download protocol IHC protocol for ANKS1B antibody 24783-1-AP Download protocol IP protocol for ANKS1B antibody 24783-1-AP Download protocol WB protocol for ANKS1B antibody 24783-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Juvenile CLN3 disease is a lysosomal cholesterol storage disorder: similarities with Niemann-Pick type C disease
Journal: EBioMedicine | Authors: Jacinda Chen | Species: human | Application: WB - Lactylation-mediated degradation of ANKS1B mitigates ischemic excitotoxicity by impairing GluN2B trafficking.
Journal: Biochem Biophys Res Commun | Authors: Ping Yang - ANKS1B in the Nucleus Accumbens Controls Escalated Cocaine Self-Administration via Regulating CBP-FoxO3 Complex.
Journal: Adv Sci (Weinh) | Authors: Liping Yang | Species: rat | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
