TOMM34 Polyclonal antibody 12196-1-AP proteintech
$149.00
In stock
SKU
12196-1-AP
| Catalog Number | 12196-1-AP |
| Synonyms | hTom34, HTOM34P, TOM34, TOMM 34, URCC3 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A375 cells, HeLa cells, PC-3 cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | A375 cells, HeLa cells, PC-3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2834 Product name: Recombinant human TOMM34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-309 aa of BC014907 Sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH Predict reactive species |
| Full Name | translocase of outer mitochondrial membrane 34 |
| Calculated Molecular Weight | 309 aa, 35 kDa |
| Observed Molecular Weight | 31-35 kDa |
| GenBank Accession Number | BC014907 |
| Gene Symbol | TOMM34 |
| Gene ID (NCBI) | 10953 |
| RRID | AB_2240906 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15785 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TOMM34 antibody 12196-1-AP | Download protocol |
| IHC protocol for TOMM34 antibody 12196-1-AP | Download protocol |
| IP protocol for TOMM34 antibody 12196-1-AP | Download protocol |
| WB protocol for TOMM34 antibody 12196-1-AP | Download protocol |
| mouse | WB Free Radic Biol Med Proteomic analysis of the glutathione-deficient LEGSKO mouse lens reveals activation of EMT signaling, loss of lens specific markers, and changes in stress response proteins. Authors - Jeremy A Whitson View Article |
| human | WB J Oral Pathol Med TOMM34 promotes cell proliferation, migration and invasion of OSCC and modulates mitochondrial function Authors - Yunyi Huang KD Validated View Article |
| rat,mouse | WB Bioact Mater Polydopamine as a biocompatible and precise mitochondrial targeted therapeutic platform for reversing myocardial ischemia-reperfusion injury. Authors - Tianjiao Zhao View Article |
| Human | Front Aging Neurosci Intraneuronal sortilin aggregation relative to granulovacuolar degeneration, tau pathogenesis and sorfra plaque formation in human hippocampal formation Authors - Juan Jiang View Article |
| Citations | 7 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:2000-1:8000 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- The proteome of granulovacuolar degeneration and neurofibrillary tangles in Alzheimer's disease.
Journal: Acta Neuropathol | Authors: David C Hondius | Application: IHC - Proteomic analysis of the glutathione-deficient LEGSKO mouse lens reveals activation of EMT signaling, loss of lens specific markers, and changes in stress response proteins.
Journal: Free Radic Biol Med | Authors: Jeremy A Whitson | Species: mouse | Application: WB - High Expression of Tomm34 and Its Correlations With Clinicopathology in Oral Squamous Cell Carcinoma.
Journal: Pathol Oncol Res | Authors: Min Cai | Species: human | Application: IHC - TOMM34 promotes cell proliferation, migration and invasion of OSCC and modulates mitochondrial function
Journal: J Oral Pathol Med | Authors: Yunyi Huang KD Validated | Species: human | Application: WB - Polydopamine as a biocompatible and precise mitochondrial targeted therapeutic platform for reversing myocardial ischemia-reperfusion injury.
Journal: Bioact Mater | Authors: Tianjiao Zhao | Species: rat,mouse | Application: WB - Intraneuronal sortilin aggregation relative to granulovacuolar degeneration, tau pathogenesis and sorfra plaque formation in human hippocampal formation
Journal: Front Aging Neurosci | Authors: Juan Jiang | Species: Human - TOMM34 promotes cell proliferation, migration and invasion of OSCC and modulates mitochondrial function
Journal: J Oral Pathol Med | Authors: Yunyi Huang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
