TRAK2 Polyclonal antibody 13770-1-AP proteintech
$149.00
In stock
SKU
13770-1-AP
| Catalog Number | 13770-1-AP |
| Synonyms | Trafficking kinesin-binding protein 2, KIAA0549, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein, ALS2CR3 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, monkey |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human liver tissue |
| Tested Applications — Positive IP detected in | HepG2 cells |
| Tested Applications — Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | human liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4753 Product name: Recombinant human TRAK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC040668 Sequence: MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDTLFLYENQDWTQSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHILSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELVRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRS Predict reactive species |
| Full Name | trafficking protein, kinesin binding 2 |
| Calculated Molecular Weight | 914 aa, 101 kDa |
| Observed Molecular Weight | 101-106 kDa |
| GenBank Accession Number | BC040668 |
| Gene Symbol | TRAK2 |
| Gene ID (NCBI) | 66008 |
| RRID | AB_2207961 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60296 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| IHC protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| IP protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| WB protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| monkey | WB Sci Adv ARMC1 partitions between distinct complexes and assembles MIRO with MTFR to control mitochondrial distribution Authors - Michael J McKenna View Article |
| human | WB Science A molecular switch for coordinating kinesin and dynein transport of mitochondrial cargo Authors - Christina Gladkova View Article |
| rat | WB Bioeng Transl Med Photobiomodulation augments the effects of mitochondrial transplantation in the treatment of spinal cord injury in rats by facilitating mitochondrial transfer to neurons via Connexin 36 Authors - Zhijie Zhu View Article |
| mouse | WB Exp Cell Res Antagomirs targeting miR-142-5p attenuate pilocarpine-induced status epilepticus in mice. Authors - Haifeng Zhang View Article |
| Citations | 8 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Trafficking kinesin-binding protein 2 (TRAK2) is a member of the TRAK family of kinesin adaptor proteins. In mammals, there are two members of the TRAK family, TRAK1 and TRAK2 (PMID: 25653102). TRAK1 and TRAK2 play roles in lysosomal and mitochondrial trafficking in cells. They function as kinesin adaptors linking kinesin heavy chain (KHC) to mitochondria (PMID: 28364549). TRAK2 has been found to act as a trafficking factor for the K+ channel Kir2.1 and γ-Aminobutyric acid type A (GABAA) receptor (PMID: 16895905; 24122114). Protocols Product Specific Protocols IF protocol for TRAK2 antibody 13770-1-AP Download protocol IHC protocol for TRAK2 antibody 13770-1-AP Download protocol IP protocol for TRAK2 antibody 13770-1-AP Download protocol WB protocol for TRAK2 antibody 13770-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- ARMC1 partitions between distinct complexes and assembles MIRO with MTFR to control mitochondrial distribution
Journal: Sci Adv | Authors: Michael J McKenna | Species: monkey | Application: WB - Adaptation of mitochondrial network dynamics and velocity of mitochondrial movement to chronic stress present in fibroblasts derived from patients with sporadic form of Alzheimer's disease.
Journal: FASEB J | Authors: Karolina Drabik | Species: human | Application: WB - Coordination of mitochondrial and cellular dynamics by the actin-based motor Myo19.
Journal: J Cell Sci | Authors: Katarzyna Majstrowicz | Species: rat | Application: WB - Antagomirs targeting miR-142-5p attenuate pilocarpine-induced status epilepticus in mice.
Journal: Exp Cell Res | Authors: Haifeng Zhang | Species: mouse | Application: WB - Photobiomodulation augments the effects of mitochondrial transplantation in the treatment of spinal cord injury in rats by facilitating mitochondrial transfer to neurons via Connexin 36
Journal: Bioeng Transl Med | Authors: Zhijie Zhu | Species: rat | Application: WB - A molecular switch for coordinating kinesin and dynein transport of mitochondrial cargo
Journal: Science | Authors: Christina Gladkova | Species: human | Application: WB - Coordination of mitochondrial and cellular dynamics by the actin-based motor Myo19.
Journal: J Cell Sci | Authors: Katarzyna Majstrowicz | Species: rat | Application: WB - Antagomirs targeting miR-142-5p attenuate pilocarpine-induced status epilepticus in mice.
Journal: Exp Cell Res | Authors: Haifeng Zhang | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
